Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AB0R90_RS16435 Genome accession   NZ_CP160217
Coordinates   3261396..3261536 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain AP52     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3256396..3266536
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R90_RS16410 (AB0R90_16410) - 3256692..3257075 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  AB0R90_RS16415 (AB0R90_16415) comA 3257097..3257741 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  AB0R90_RS16420 (AB0R90_16420) comP 3257822..3260131 (-) 2310 WP_099567053.1 histidine kinase Regulator
  AB0R90_RS16425 (AB0R90_16425) comX 3260151..3260327 (-) 177 WP_007408675.1 competence pheromone ComX -
  AB0R90_RS16430 (AB0R90_16430) comQ 3260327..3261265 (-) 939 WP_020954300.1 polyprenyl synthetase family protein Regulator
  AB0R90_RS16435 (AB0R90_16435) degQ 3261396..3261536 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  AB0R90_RS16440 (AB0R90_16440) - 3262001..3262342 (+) 342 WP_099567054.1 hypothetical protein -
  AB0R90_RS16445 (AB0R90_16445) - 3262349..3263572 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  AB0R90_RS16450 (AB0R90_16450) - 3263702..3265168 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  AB0R90_RS16455 (AB0R90_16455) - 3265186..3265737 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  AB0R90_RS16460 (AB0R90_16460) - 3265834..3266232 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1019489 AB0R90_RS16435 WP_003152043.1 3261396..3261536(-) (degQ) [Bacillus velezensis strain AP52]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1019489 AB0R90_RS16435 WP_003152043.1 3261396..3261536(-) (degQ) [Bacillus velezensis strain AP52]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment