Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | AB0R66_RS16215 | Genome accession | NZ_CP160214 |
| Coordinates | 3286417..3286557 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain JJ747 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3281417..3291557
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB0R66_RS16190 (AB0R66_16190) | - | 3281713..3282096 (-) | 384 | WP_327942488.1 | hotdog fold thioesterase | - |
| AB0R66_RS16195 (AB0R66_16195) | comA | 3282118..3282762 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| AB0R66_RS16200 (AB0R66_16200) | comP | 3282843..3285152 (-) | 2310 | WP_366598067.1 | histidine kinase | Regulator |
| AB0R66_RS16205 (AB0R66_16205) | comX | 3285172..3285348 (-) | 177 | WP_007408675.1 | competence pheromone ComX | - |
| AB0R66_RS16210 (AB0R66_16210) | comQ | 3285348..3286232 (-) | 885 | WP_061862640.1 | class 1 isoprenoid biosynthesis enzyme | Regulator |
| AB0R66_RS16215 (AB0R66_16215) | degQ | 3286417..3286557 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| AB0R66_RS16220 (AB0R66_16220) | - | 3287020..3287361 (+) | 342 | WP_007408677.1 | hypothetical protein | - |
| AB0R66_RS16225 (AB0R66_16225) | - | 3287368..3288591 (-) | 1224 | WP_007408678.1 | EAL and HDOD domain-containing protein | - |
| AB0R66_RS16230 (AB0R66_16230) | - | 3288721..3290187 (-) | 1467 | WP_014305722.1 | nicotinate phosphoribosyltransferase | - |
| AB0R66_RS16235 (AB0R66_16235) | - | 3290205..3290756 (-) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| AB0R66_RS16240 (AB0R66_16240) | - | 3290853..3291247 (-) | 395 | Protein_3135 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=1019262 AB0R66_RS16215 WP_003152043.1 3286417..3286557(-) (degQ) [Bacillus velezensis strain JJ747]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=1019262 AB0R66_RS16215 WP_003152043.1 3286417..3286557(-) (degQ) [Bacillus velezensis strain JJ747]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCTATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCTATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |