Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AB0R66_RS16215 Genome accession   NZ_CP160214
Coordinates   3286417..3286557 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain JJ747     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3281417..3291557
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R66_RS16190 (AB0R66_16190) - 3281713..3282096 (-) 384 WP_327942488.1 hotdog fold thioesterase -
  AB0R66_RS16195 (AB0R66_16195) comA 3282118..3282762 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  AB0R66_RS16200 (AB0R66_16200) comP 3282843..3285152 (-) 2310 WP_366598067.1 histidine kinase Regulator
  AB0R66_RS16205 (AB0R66_16205) comX 3285172..3285348 (-) 177 WP_007408675.1 competence pheromone ComX -
  AB0R66_RS16210 (AB0R66_16210) comQ 3285348..3286232 (-) 885 WP_061862640.1 class 1 isoprenoid biosynthesis enzyme Regulator
  AB0R66_RS16215 (AB0R66_16215) degQ 3286417..3286557 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  AB0R66_RS16220 (AB0R66_16220) - 3287020..3287361 (+) 342 WP_007408677.1 hypothetical protein -
  AB0R66_RS16225 (AB0R66_16225) - 3287368..3288591 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  AB0R66_RS16230 (AB0R66_16230) - 3288721..3290187 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  AB0R66_RS16235 (AB0R66_16235) - 3290205..3290756 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  AB0R66_RS16240 (AB0R66_16240) - 3290853..3291247 (-) 395 Protein_3135 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1019262 AB0R66_RS16215 WP_003152043.1 3286417..3286557(-) (degQ) [Bacillus velezensis strain JJ747]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1019262 AB0R66_RS16215 WP_003152043.1 3286417..3286557(-) (degQ) [Bacillus velezensis strain JJ747]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCTATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment