Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AB0R70_RS14905 Genome accession   NZ_CP160212
Coordinates   3031873..3032013 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain JM204     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3026873..3037013
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R70_RS14880 (AB0R70_14880) - 3027213..3027596 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  AB0R70_RS14885 (AB0R70_14885) comA 3027618..3028262 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  AB0R70_RS14890 (AB0R70_14890) comP 3028343..3030634 (-) 2292 WP_160223246.1 histidine kinase Regulator
  AB0R70_RS14895 (AB0R70_14895) comX 3030646..3030810 (-) 165 WP_061581461.1 competence pheromone ComX -
  AB0R70_RS14900 (AB0R70_14900) - 3030810..3031688 (-) 879 WP_038460875.1 polyprenyl synthetase family protein -
  AB0R70_RS14905 (AB0R70_14905) degQ 3031873..3032013 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  AB0R70_RS14910 (AB0R70_14910) - 3032478..3032819 (+) 342 WP_069006914.1 hypothetical protein -
  AB0R70_RS14915 (AB0R70_14915) - 3032826..3034049 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  AB0R70_RS14920 (AB0R70_14920) - 3034179..3035645 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  AB0R70_RS14925 (AB0R70_14925) - 3035663..3036214 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  AB0R70_RS14930 (AB0R70_14930) - 3036310..3036708 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1019111 AB0R70_RS14905 WP_003152043.1 3031873..3032013(-) (degQ) [Bacillus velezensis strain JM204]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1019111 AB0R70_RS14905 WP_003152043.1 3031873..3032013(-) (degQ) [Bacillus velezensis strain JM204]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment