Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   AABJ69_RS13370 Genome accession   NZ_AP027666
Coordinates   2728845..2729474 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain PSS-04     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2719673..2757310 2728845..2729474 within 0


Gene organization within MGE regions


Location: 2719673..2757310
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AABJ69_RS13320 (VEE17_25740) tusE 2719944..2720273 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  AABJ69_RS13325 (VEE17_25750) yccX 2720270..2720548 (-) 279 WP_000048252.1 acylphosphatase -
  AABJ69_RS13330 (VEE17_25760) rlmI 2720643..2721833 (+) 1191 WP_000116297.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  AABJ69_RS13335 (VEE17_25770) hspQ 2721891..2722208 (+) 318 WP_001295356.1 heat shock protein HspQ -
  AABJ69_RS13340 (VEE17_25780) yccU 2722253..2722666 (-) 414 WP_001301418.1 CoA-binding protein -
  AABJ69_RS13345 (VEE17_25790) yccT 2722839..2723501 (+) 663 WP_000847791.1 DUF2057 family protein -
  AABJ69_RS13350 (VEE17_25800) mgsA 2723597..2724055 (+) 459 WP_000424181.1 methylglyoxal synthase -
  AABJ69_RS13355 (VEE17_25810) helD 2724087..2726141 (-) 2055 WP_001295354.1 DNA helicase IV -
  AABJ69_RS13360 (VEE17_25820) yccF 2726264..2726710 (+) 447 WP_001261235.1 YccF domain-containing protein -
  AABJ69_RS13365 (VEE17_25830) yccS 2726720..2728882 (+) 2163 WP_000875061.1 YccS family putative transporter -
  AABJ69_RS13370 (VEE17_25840) sxy/tfoX 2728845..2729474 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  AABJ69_RS13375 (VEE17_25850) sulA 2729693..2730202 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  AABJ69_RS13380 (VEE17_25870) ompA 2730559..2731599 (+) 1041 WP_241233288.1 porin OmpA -
  AABJ69_RS13385 (VEE17_25880) matP 2731675..2732127 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  AABJ69_RS13390 (VEE17_25890) ycbZ 2732313..2734073 (+) 1761 WP_000156518.1 Lon protease family protein -
  AABJ69_RS13395 (VEE17_25900) fabA 2734142..2734660 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  AABJ69_RS13400 (VEE17_25910) rmf 2734730..2734897 (-) 168 WP_000828648.1 ribosome modulation factor -
  AABJ69_RS13405 (VEE17_25920) pqiC 2735153..2735716 (-) 564 WP_000759120.1 membrane integrity-associated transporter subunit PqiC -
  AABJ69_RS13410 (VEE17_25930) pqiB 2735713..2737353 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  AABJ69_RS13415 (VEE17_25940) pqiA 2737358..2738611 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  AABJ69_RS13420 (VEE17_25950) uup 2738741..2740648 (-) 1908 WP_000053099.1 ABC transporter ATP-binding protein -
  AABJ69_RS13425 (VEE17_25960) rlmKL 2740660..2742768 (-) 2109 WP_001086539.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  AABJ69_RS13430 (VEE17_25970) ycbX 2743012..2744121 (+) 1110 WP_000212426.1 6-N-hydroxylaminopurine resistance protein YcbX -
  AABJ69_RS13435 (VEE17_25980) zapC 2744118..2744660 (-) 543 WP_001295353.1 cell division protein ZapC -
  AABJ69_RS13440 (VEE17_25990) pyrD 2744834..2745844 (-) 1011 WP_001295352.1 quinone-dependent dihydroorotate dehydrogenase -
  AABJ69_RS13445 (VEE17_26000) ycbF 2745955..2746692 (-) 738 WP_001111465.1 fimbrial chaperone -
  AABJ69_RS13450 (VEE17_26010) ycbV 2746658..2747173 (-) 516 WP_241233286.1 fimbrial protein -
  AABJ69_RS13455 (VEE17_26020) ycbU 2747181..2747723 (-) 543 WP_000730614.1 fimbrial protein -
  AABJ69_RS13460 (VEE17_26030) elfG 2747735..2748805 (-) 1071 WP_001165668.1 fimbrial protein -
  AABJ69_RS13465 (VEE17_26040) - 2748796..2750814 (-) 2019 Protein_2634 fimbrial biogenesis usher protein -
  AABJ69_RS13475 (VEE17_26070) - 2752145..2752732 (-) 588 Protein_2636 FimD/PapC N-terminal domain-containing protein -
  AABJ69_RS13480 (VEE17_26080) elfD 2752757..2753458 (-) 702 WP_001295349.1 molecular chaperone -
  AABJ69_RS13485 (VEE17_26090) elfA 2753541..2754080 (-) 540 WP_000750293.1 fimbrial protein -
  AABJ69_RS13490 (VEE17_26100) ssuE 2754436..2755011 (+) 576 WP_001263933.1 NADPH-dependent FMN reductase -
  AABJ69_RS13495 (VEE17_26110) ssuA 2755004..2755963 (+) 960 WP_001244308.1 aliphatic sulfonate ABC transporter substrate-binding protein SsuA -
  AABJ69_RS13500 (VEE17_26120) ssuD 2755960..2757105 (+) 1146 WP_000056006.1 FMNH2-dependent alkanesulfonate monooxygenase -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=101910 AABJ69_RS13370 WP_000839153.1 2728845..2729474(-) (sxy/tfoX) [Escherichia coli strain PSS-04]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=101910 AABJ69_RS13370 WP_000839153.1 2728845..2729474(-) (sxy/tfoX) [Escherichia coli strain PSS-04]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1


Multiple sequence alignment