Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   AABJ87_RS02575 Genome accession   NZ_AP027642
Coordinates   511234..511863 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain PSJ-32-1     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 502062..539699 511234..511863 within 0


Gene organization within MGE regions


Location: 502062..539699
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AABJ87_RS02525 (VEE41_04900) tusE 502333..502662 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  AABJ87_RS02530 (VEE41_04910) yccX 502659..502937 (-) 279 WP_000048252.1 acylphosphatase -
  AABJ87_RS02535 (VEE41_04920) rlmI 503032..504222 (+) 1191 WP_000116297.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  AABJ87_RS02540 (VEE41_04930) hspQ 504280..504597 (+) 318 WP_001295356.1 heat shock protein HspQ -
  AABJ87_RS02545 (VEE41_04940) yccU 504642..505055 (-) 414 WP_001301418.1 CoA-binding protein -
  AABJ87_RS02550 (VEE41_04950) yccT 505228..505890 (+) 663 WP_000847791.1 DUF2057 family protein -
  AABJ87_RS02555 (VEE41_04960) mgsA 505986..506444 (+) 459 WP_000424181.1 methylglyoxal synthase -
  AABJ87_RS02560 (VEE41_04970) helD 506476..508530 (-) 2055 WP_001295354.1 DNA helicase IV -
  AABJ87_RS02565 (VEE41_04980) yccF 508653..509099 (+) 447 WP_001261235.1 YccF domain-containing protein -
  AABJ87_RS02570 (VEE41_04990) yccS 509109..511271 (+) 2163 WP_000875061.1 YccS family putative transporter -
  AABJ87_RS02575 (VEE41_05000) sxy/tfoX 511234..511863 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  AABJ87_RS02580 (VEE41_05010) sulA 512082..512591 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  AABJ87_RS02585 (VEE41_05030) ompA 512948..513988 (+) 1041 WP_241233288.1 porin OmpA -
  AABJ87_RS02590 (VEE41_05040) matP 514064..514516 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  AABJ87_RS02595 (VEE41_05050) ycbZ 514702..516462 (+) 1761 WP_000156518.1 Lon protease family protein -
  AABJ87_RS02600 (VEE41_05060) fabA 516531..517049 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  AABJ87_RS02605 (VEE41_05070) rmf 517119..517286 (-) 168 WP_000828648.1 ribosome modulation factor -
  AABJ87_RS02610 (VEE41_05080) pqiC 517542..518105 (-) 564 WP_000759120.1 membrane integrity-associated transporter subunit PqiC -
  AABJ87_RS02615 (VEE41_05090) pqiB 518102..519742 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  AABJ87_RS02620 (VEE41_05100) pqiA 519747..521000 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  AABJ87_RS02625 (VEE41_05110) uup 521130..523037 (-) 1908 WP_000053099.1 ABC transporter ATP-binding protein -
  AABJ87_RS02630 (VEE41_05120) rlmKL 523049..525157 (-) 2109 WP_001086539.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  AABJ87_RS02635 (VEE41_05130) ycbX 525401..526510 (+) 1110 WP_000212426.1 6-N-hydroxylaminopurine resistance protein YcbX -
  AABJ87_RS02640 (VEE41_05140) zapC 526507..527049 (-) 543 WP_001295353.1 cell division protein ZapC -
  AABJ87_RS02645 (VEE41_05150) pyrD 527223..528233 (-) 1011 WP_001295352.1 quinone-dependent dihydroorotate dehydrogenase -
  AABJ87_RS02650 (VEE41_05160) ycbF 528344..529081 (-) 738 WP_001111465.1 fimbrial chaperone -
  AABJ87_RS02655 (VEE41_05170) ycbV 529047..529562 (-) 516 WP_241233286.1 fimbrial protein -
  AABJ87_RS02660 (VEE41_05180) ycbU 529570..530112 (-) 543 WP_000730614.1 fimbrial protein -
  AABJ87_RS02665 (VEE41_05190) elfG 530124..531194 (-) 1071 WP_001165668.1 fimbrial protein -
  AABJ87_RS02670 (VEE41_05200) - 531185..533203 (-) 2019 Protein_525 fimbrial biogenesis usher protein -
  AABJ87_RS02680 (VEE41_05230) - 534534..535121 (-) 588 Protein_527 FimD/PapC N-terminal domain-containing protein -
  AABJ87_RS02685 (VEE41_05240) elfD 535146..535847 (-) 702 WP_001295349.1 molecular chaperone -
  AABJ87_RS02690 (VEE41_05250) elfA 535930..536469 (-) 540 WP_000750293.1 fimbrial protein -
  AABJ87_RS02695 (VEE41_05260) ssuE 536825..537400 (+) 576 WP_001263933.1 NADPH-dependent FMN reductase -
  AABJ87_RS02700 (VEE41_05270) ssuA 537393..538352 (+) 960 WP_001244308.1 aliphatic sulfonate ABC transporter substrate-binding protein SsuA -
  AABJ87_RS02705 (VEE41_05280) ssuD 538349..539494 (+) 1146 WP_000056006.1 FMNH2-dependent alkanesulfonate monooxygenase -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=101831 AABJ87_RS02575 WP_000839153.1 511234..511863(-) (sxy/tfoX) [Escherichia coli strain PSJ-32-1]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=101831 AABJ87_RS02575 WP_000839153.1 511234..511863(-) (sxy/tfoX) [Escherichia coli strain PSJ-32-1]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1


Multiple sequence alignment