Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ABXV02_RS09760 Genome accession   NZ_CP159912
Coordinates   1827526..1827699 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain PY79     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1822526..1832699
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABXV02_RS09715 comGE 1822877..1823224 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  ABXV02_RS09720 comGF 1823250..1823633 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  ABXV02_RS09725 comGG 1823634..1824008 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  ABXV02_RS09730 spoIITA 1824079..1824258 (+) 180 WP_003230176.1 YqzE family protein -
  ABXV02_RS09735 yqzG 1824300..1824626 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  ABXV02_RS09740 tapA 1824898..1825659 (+) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  ABXV02_RS09745 sipW 1825643..1826215 (+) 573 WP_003246088.1 signal peptidase I SipW -
  ABXV02_RS09750 tasA 1826279..1827064 (+) 786 WP_004398632.1 biofilm matrix protein TasA -
  ABXV02_RS09755 sinR 1827157..1827492 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ABXV02_RS09760 sinI 1827526..1827699 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  ABXV02_RS09765 yqhG 1827882..1828676 (-) 795 WP_003230200.1 YqhG family protein -
  ABXV02_RS09770 hepAA 1828697..1830370 (-) 1674 WP_004398544.1 SNF2-related protein -
  ABXV02_RS09775 gcvT 1830812..1831900 (+) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1016748 ABXV02_RS09760 WP_003230187.1 1827526..1827699(-) (sinI) [Bacillus subtilis strain PY79]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1016748 ABXV02_RS09760 WP_003230187.1 1827526..1827699(-) (sinI) [Bacillus subtilis strain PY79]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment