Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPOKI128_RS05940 Genome accession   NZ_CP006822
Coordinates   1244986..1245099 (+) Length   37 a.a.
NCBI ID   WP_001217868.1    Uniprot ID   -
Organism   Helicobacter pylori oki128     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1239986..1250099
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPOKI128_RS05915 (HPOKI128_06120) - 1240046..1242268 (+) 2223 WP_025288487.1 AAA family ATPase -
  HPOKI128_RS05920 (HPOKI128_06125) panD 1242258..1242608 (+) 351 WP_025288488.1 aspartate 1-decarboxylase -
  HPOKI128_RS05925 (HPOKI128_06130) - 1242619..1242912 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  HPOKI128_RS05930 (HPOKI128_06135) - 1242912..1243907 (+) 996 WP_025288489.1 PDZ domain-containing protein -
  HPOKI128_RS05935 (HPOKI128_06140) comB6 1243915..1244970 (+) 1056 WP_025223380.1 P-type conjugative transfer protein TrbL Machinery gene
  HPOKI128_RS05940 (HPOKI128_06145) comB7 1244986..1245099 (+) 114 WP_001217868.1 hypothetical protein Machinery gene
  HPOKI128_RS05945 (HPOKI128_06150) comB8 1245096..1245839 (+) 744 WP_025223379.1 type IV secretion system protein Machinery gene
  HPOKI128_RS05950 (HPOKI128_06155) comB9 1245839..1246801 (+) 963 WP_025223378.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPOKI128_RS05955 (HPOKI128_06160) comB10 1246794..1247930 (+) 1137 WP_025223377.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPOKI128_RS05960 (HPOKI128_06165) - 1248000..1249412 (+) 1413 WP_025288490.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4323.29 Da        Isoelectric Point: 9.3572

>NTDB_id=101239 HPOKI128_RS05940 WP_001217868.1 1244986..1245099(+) (comB7) [Helicobacter pylori oki128]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=101239 HPOKI128_RS05940 WP_001217868.1 1244986..1245099(+) (comB7) [Helicobacter pylori oki128]
ATGAGAATTTTTTTTGTCATTATGGGAATCATGTTATTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTGAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919


Multiple sequence alignment