Detailed information NTG1010977

Bioinformatically predicted

Overview

• Name: comGG
• Type: Machinery gene
• Locus tag: H1W90_RS08890
• Genome accession: NZ_LR822033
• Coordinates: 1726242..1726559 (-)
• Length: 105 a.a.
• NCBI ID: WP_002952035.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus isolate STH_CIRM_1048
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1721242..1731559

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
H1W90_RS08860 (STHERMO_1986)	-	1721601..1722263 (-)	663	WP_180481124.1	CPBP family intramembrane glutamic endopeptidase	-
H1W90_RS08865 (STHERMO_1987)	-	1722360..1722803 (-)	444	WP_180481125.1	CAAX protease	-
H1W90_RS10195 (STHERMO_1988)	-	1722877..1723215 (-)	339	WP_224103672.1	CPBP family intramembrane glutamic endopeptidase	-
H1W90_RS10200 (STHERMO_1989)	-	1723259..1723534 (-)	276	WP_011681681.1	hypothetical protein	-
H1W90_RS08875 (STHERMO_1990)	-	1723546..1723743 (-)	198	WP_002885716.1	helix-turn-helix transcriptional regulator	-
H1W90_RS08880 (STHERMO_1991)	-	1723992..1725185 (-)	1194	WP_096811682.1	acetate kinase	-
H1W90_RS08885 (STHERMO_1992)	comGH	1725241..1726197 (-)	957	WP_180481126.1	class I SAM-dependent methyltransferase	Machinery gene
H1W90_RS08890 (STHERMO_1993)	comGG	1726242..1726559 (-)	318	WP_002952035.1	competence type IV pilus minor pilin ComGG	Machinery gene
H1W90_RS08895 (STHERMO_1994)	comGF	1726537..1726974 (-)	438	WP_011681686.1	competence type IV pilus minor pilin ComGF	Machinery gene
H1W90_RS08900 (STHERMO_1995)	comGE	1726958..1727251 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	Machinery gene
H1W90_RS08905 (STHERMO_1996)	comGD	1727223..1727651 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
H1W90_RS08910 (STHERMO_1997)	comGC	1727611..1727937 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
H1W90_RS08915 (STHERMO_1998)	comGB	1727934..1729034 (-)	1101	WP_116920398.1	competence type IV pilus assembly protein ComGB	Machinery gene
H1W90_RS08920 (STHERMO_1999)	comGA/cglA/cilD	1728916..1729857 (-)	942	WP_022096896.1	competence type IV pilus ATPase ComGA	Machinery gene
H1W90_RS08925 (STHERMO_2000)	-	1729938..1730300 (-)	363	WP_180481127.1	DUF1033 family protein	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11824.93 Da
• Isoelectric Point: 10.6334

>NTDB_id=1010977 H1W90_RS08890 WP_002952035.1 1726242..1726559(-) (comGG) [Streptococcus thermophilus isolate STH_CIRM_1048]
MLLKKQVRGGVLLYALFMAGIFTLLLQVYLERVVASSRQNQAQIVASQSRLMAEMTMDLVDKEAGAFSFSQGTTTYEVKG
KQVIVRVASKGQIKTYRYVKKQDQK

Nucleotide

• Length: 318 bp

>NTDB_id=1010977 H1W90_RS08890 WP_002952035.1 1726242..1726559(-) (comGG) [Streptococcus thermophilus isolate STH_CIRM_1048]
ATGCTTTTGAAAAAACAGGTTAGGGGAGGCGTTCTTCTCTACGCTCTTTTTATGGCTGGCATTTTTACACTCCTTCTTCA
GGTTTATCTGGAACGGGTGGTAGCTAGCTCTAGACAAAACCAAGCGCAAATAGTGGCCAGTCAAAGCCGTCTCATGGCAG
AGATGACTATGGACTTGGTGGATAAGGAAGCAGGTGCTTTTAGTTTTTCTCAGGGGACTACGACTTACGAGGTTAAGGGT
AAGCAAGTGATTGTCAGAGTTGCCAGTAAAGGCCAAATCAAGACCTATCGTTATGTGAAGAAACAAGATCAGAAATAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGG	Streptococcus mutans UA140	45.455	94.286	0.429
comGG	Streptococcus mutans UA159	45.455	94.286	0.429
comGG/cglG	Streptococcus pneumoniae Rx1	42.222	85.714	0.362
comGG/cglG	Streptococcus pneumoniae D39	42.222	85.714	0.362
comGG/cglG	Streptococcus pneumoniae R6	42.222	85.714	0.362
comGG/cglG	Streptococcus pneumoniae TIGR4	42.222	85.714	0.362