Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | H1W91_RS04625 | Genome accession | NZ_LR822032 |
| Coordinates | 876654..876854 (+) | Length | 66 a.a. |
| NCBI ID | WP_006531882.1 | Uniprot ID | A0ABP2DHE2 |
| Organism | Streptococcus thermophilus isolate STH_CIRM_1050 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 871654..881854
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1W91_RS04580 (STHERMO_0994) | - | 873293..873514 (+) | 222 | WP_101415610.1 | Blp family class II bacteriocin | - |
| H1W91_RS04585 (STHERMO_0995) | - | 873566..873793 (+) | 228 | WP_058621356.1 | bacteriocin class II family protein | - |
| H1W91_RS04590 (STHERMO_0996) | - | 873815..874198 (+) | 384 | WP_095559354.1 | hypothetical protein | - |
| H1W91_RS04595 | - | 874195..874398 (+) | 204 | Protein_851 | garvicin Q family class II bacteriocin | - |
| H1W91_RS04600 (STHERMO_0997) | - | 874410..874712 (+) | 303 | WP_015695689.1 | bacteriocin immunity protein | - |
| H1W91_RS04605 (STHERMO_0998) | - | 874870..875103 (+) | 234 | WP_095559355.1 | Blp family class II bacteriocin | - |
| H1W91_RS04610 (STHERMO_0999) | - | 875293..875550 (+) | 258 | WP_095559356.1 | garvicin Q family class II bacteriocin | - |
| H1W91_RS04615 (STHERMO_1000) | - | 875550..875858 (+) | 309 | WP_018364976.1 | bacteriocin immunity protein | - |
| H1W91_RS04620 (STHERMO_1001) | - | 876233..876412 (+) | 180 | WP_095559357.1 | hypothetical protein | - |
| H1W91_RS04625 (STHERMO_1002) | cipB | 876654..876854 (+) | 201 | WP_006531882.1 | bacteriocin class II family protein | Regulator |
| H1W91_RS04630 (STHERMO_1003) | - | 876880..877062 (+) | 183 | WP_006531883.1 | Blp family class II bacteriocin | - |
| H1W91_RS04635 (STHERMO_1004) | - | 877679..877909 (+) | 231 | WP_043878356.1 | bacteriocin | - |
| H1W91_RS04640 (STHERMO_1005) | - | 877998..878309 (+) | 312 | WP_003066586.1 | hypothetical protein | - |
| H1W91_RS04645 | - | 878523..878615 (+) | 93 | Protein_861 | Blp family class II bacteriocin | - |
| H1W91_RS04650 (STHERMO_1006) | - | 878673..879071 (+) | 399 | WP_232087080.1 | immunity protein | - |
| H1W91_RS04655 (STHERMO_1007) | - | 879259..880305 (+) | 1047 | WP_095559358.1 | thioredoxin fold domain-containing protein | - |
| H1W91_RS04660 (STHERMO_1008) | - | 880837..881601 (+) | 765 | WP_232086163.1 | DUF6261 family protein | - |
Sequence
Protein
Download Length: 66 a.a. Molecular weight: 6536.51 Da Isoelectric Point: 6.1394
>NTDB_id=1010818 H1W91_RS04625 WP_006531882.1 876654..876854(+) (cipB) [Streptococcus thermophilus isolate STH_CIRM_1050]
MNTKAFEQFDVMTDAELSTVEGGKSKEGRNMGCILGTAGMAGAGFLVAGPAGAAALGGATALRVCR
MNTKAFEQFDVMTDAELSTVEGGKSKEGRNMGCILGTAGMAGAGFLVAGPAGAAALGGATALRVCR
Nucleotide
Download Length: 201 bp
>NTDB_id=1010818 H1W91_RS04625 WP_006531882.1 876654..876854(+) (cipB) [Streptococcus thermophilus isolate STH_CIRM_1050]
ATGAATACAAAAGCATTTGAACAATTTGATGTAATGACAGATGCAGAACTTTCAACTGTTGAAGGTGGGAAAAGTAAAGA
AGGAAGAAATATGGGATGTATACTTGGCACTGCAGGTATGGCAGGAGCAGGCTTTTTAGTAGCAGGACCAGCAGGTGCTG
CCGCACTTGGCGGTGCTACCGCACTAAGAGTTTGTAGATAA
ATGAATACAAAAGCATTTGAACAATTTGATGTAATGACAGATGCAGAACTTTCAACTGTTGAAGGTGGGAAAAGTAAAGA
AGGAAGAAATATGGGATGTATACTTGGCACTGCAGGTATGGCAGGAGCAGGCTTTTTAGTAGCAGGACCAGCAGGTGCTG
CCGCACTTGGCGGTGCTACCGCACTAAGAGTTTGTAGATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
52.174 |
69.697 |
0.364 |