Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   H1X08_RS05295 Genome accession   NZ_LR822025
Coordinates   1035675..1035875 (-) Length   66 a.a.
NCBI ID   WP_006531882.1    Uniprot ID   A0ABP2DHE2
Organism   Streptococcus thermophilus isolate STH_CIRM_961     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1030675..1040875
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H1X08_RS05260 (STHERMO_1189) - 1031052..1031816 (-) 765 WP_232086914.1 DUF6261 family protein -
  H1X08_RS05265 (STHERMO_1190) - 1032348..1033271 (-) 924 WP_179972945.1 LPXTG cell wall anchor domain-containing protein -
  H1X08_RS05270 (STHERMO_1191) - 1033452..1033856 (-) 405 WP_015695682.1 hypothetical protein -
  H1X08_RS05275 - 1033914..1034006 (-) 93 Protein_998 Blp family class II bacteriocin -
  H1X08_RS05280 (STHERMO_1192) - 1034220..1034531 (-) 312 WP_003066586.1 hypothetical protein -
  H1X08_RS05285 (STHERMO_1193) - 1034620..1034850 (-) 231 WP_043878356.1 bacteriocin -
  H1X08_RS05290 (STHERMO_1195) - 1035467..1035649 (-) 183 WP_180481989.1 Blp family class II bacteriocin -
  H1X08_RS05295 (STHERMO_1196) cipB 1035675..1035875 (-) 201 WP_006531882.1 bacteriocin class II family protein Regulator
  H1X08_RS05300 (STHERMO_1198) - 1036065..1036298 (-) 234 WP_095559355.1 Blp family class II bacteriocin -
  H1X08_RS05305 (STHERMO_1199) - 1036456..1036758 (-) 303 WP_015695689.1 bacteriocin immunity protein -
  H1X08_RS05310 - 1036770..1036973 (-) 204 Protein_1005 garvicin Q family class II bacteriocin -
  H1X08_RS05315 (STHERMO_1201) - 1036970..1037353 (-) 384 WP_018364971.1 hypothetical protein -
  H1X08_RS05320 (STHERMO_1202) - 1037375..1037602 (-) 228 WP_058621356.1 bacteriocin class II family protein -
  H1X08_RS05325 (STHERMO_1203) - 1037654..1037875 (-) 222 WP_101415610.1 Blp family class II bacteriocin -
  H1X08_RS05330 (STHERMO_1204) comA/nlmT 1038150..1040297 (+) 2148 WP_095559353.1 peptide cleavage/export ABC transporter Regulator

Sequence

Protein


Download         Length: 66 a.a.        Molecular weight: 6536.51 Da        Isoelectric Point: 6.1394

>NTDB_id=1010185 H1X08_RS05295 WP_006531882.1 1035675..1035875(-) (cipB) [Streptococcus thermophilus isolate STH_CIRM_961]
MNTKAFEQFDVMTDAELSTVEGGKSKEGRNMGCILGTAGMAGAGFLVAGPAGAAALGGATALRVCR

Nucleotide


Download         Length: 201 bp        

>NTDB_id=1010185 H1X08_RS05295 WP_006531882.1 1035675..1035875(-) (cipB) [Streptococcus thermophilus isolate STH_CIRM_961]
ATGAATACAAAAGCATTTGAACAATTTGATGTAATGACAGATGCAGAACTTTCAACTGTTGAAGGTGGGAAAAGTAAAGA
AGGAAGAAATATGGGATGTATACTTGGCACTGCAGGTATGGCAGGAGCAGGCTTTTTAGTAGCAGGACCAGCAGGTGCTG
CCGCACTTGGCGGTGCTACCGCACTAAGAGTTTGTAGATAA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-58)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

52.174

69.697

0.364