Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | H0513_RS05105 | Genome accession | NZ_LR822023 |
| Coordinates | 951654..951854 (+) | Length | 66 a.a. |
| NCBI ID | WP_006531882.1 | Uniprot ID | A0ABP2DHE2 |
| Organism | Streptococcus thermophilus isolate STH_CIRM_368 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 946654..956854
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H0513_RS05060 (STHERMO_1123) | - | 948292..948513 (+) | 222 | WP_101415610.1 | Blp family class II bacteriocin | - |
| H0513_RS05065 (STHERMO_1124) | - | 948565..948792 (+) | 228 | WP_058621356.1 | bacteriocin class II family protein | - |
| H0513_RS05070 (STHERMO_1125) | - | 948814..949197 (+) | 384 | WP_095559354.1 | hypothetical protein | - |
| H0513_RS05075 | - | 949194..949397 (+) | 204 | Protein_944 | garvicin Q family class II bacteriocin | - |
| H0513_RS05080 (STHERMO_1127) | - | 949409..949711 (+) | 303 | WP_015695689.1 | bacteriocin immunity protein | - |
| H0513_RS05085 (STHERMO_1128) | - | 949869..950102 (+) | 234 | WP_179972944.1 | Blp family class II bacteriocin | - |
| H0513_RS05090 (STHERMO_1129) | - | 950292..950549 (+) | 258 | WP_095559356.1 | garvicin Q family class II bacteriocin | - |
| H0513_RS05095 (STHERMO_1130) | - | 950549..950857 (+) | 309 | WP_018364976.1 | bacteriocin immunity protein | - |
| H0513_RS05100 (STHERMO_1131) | - | 951232..951411 (+) | 180 | WP_095559357.1 | hypothetical protein | - |
| H0513_RS05105 (STHERMO_1132) | cipB | 951654..951854 (+) | 201 | WP_006531882.1 | bacteriocin class II family protein | Regulator |
| H0513_RS05110 (STHERMO_1133) | - | 951880..952062 (+) | 183 | WP_006531883.1 | Blp family class II bacteriocin | - |
| H0513_RS05115 (STHERMO_1134) | - | 952679..952909 (+) | 231 | WP_043878356.1 | bacteriocin | - |
| H0513_RS05120 (STHERMO_1135) | - | 952998..953309 (+) | 312 | WP_003066586.1 | hypothetical protein | - |
| H0513_RS05125 | - | 953523..953615 (+) | 93 | Protein_954 | Blp family class II bacteriocin | - |
| H0513_RS05130 (STHERMO_1136) | - | 953673..954077 (+) | 405 | WP_015695682.1 | hypothetical protein | - |
| H0513_RS05135 (STHERMO_1137) | - | 954258..955181 (+) | 924 | WP_179972945.1 | LPXTG cell wall anchor domain-containing protein | - |
| H0513_RS05140 (STHERMO_1138) | - | 955742..956476 (+) | 735 | WP_232086883.1 | DUF6261 family protein | - |
Sequence
Protein
Download Length: 66 a.a. Molecular weight: 6536.51 Da Isoelectric Point: 6.1394
>NTDB_id=1010068 H0513_RS05105 WP_006531882.1 951654..951854(+) (cipB) [Streptococcus thermophilus isolate STH_CIRM_368]
MNTKAFEQFDVMTDAELSTVEGGKSKEGRNMGCILGTAGMAGAGFLVAGPAGAAALGGATALRVCR
MNTKAFEQFDVMTDAELSTVEGGKSKEGRNMGCILGTAGMAGAGFLVAGPAGAAALGGATALRVCR
Nucleotide
Download Length: 201 bp
>NTDB_id=1010068 H0513_RS05105 WP_006531882.1 951654..951854(+) (cipB) [Streptococcus thermophilus isolate STH_CIRM_368]
ATGAATACAAAAGCATTTGAACAATTTGATGTAATGACAGATGCAGAACTTTCAACTGTTGAAGGTGGGAAAAGTAAAGA
AGGAAGAAATATGGGATGTATACTTGGCACTGCAGGTATGGCAGGAGCAGGCTTTTTAGTAGCAGGACCAGCAGGTGCTG
CCGCACTTGGCGGTGCTACCGCACTAAGAGTTTGTAGATAA
ATGAATACAAAAGCATTTGAACAATTTGATGTAATGACAGATGCAGAACTTTCAACTGTTGAAGGTGGGAAAAGTAAAGA
AGGAAGAAATATGGGATGTATACTTGGCACTGCAGGTATGGCAGGAGCAGGCTTTTTAGTAGCAGGACCAGCAGGTGCTG
CCGCACTTGGCGGTGCTACCGCACTAAGAGTTTGTAGATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
52.174 |
69.697 |
0.364 |