Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   ABM478_RS12820 Genome accession   NZ_CP157848
Coordinates   2509092..2509370 (+) Length   92 a.a.
NCBI ID   WP_146719285.1    Uniprot ID   -
Organism   Bacillus cereus strain B9     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2498941..2541634 2509092..2509370 within 0


Gene organization within MGE regions


Location: 2498941..2541634
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABM478_RS12730 - 2498941..2499204 (+) 264 WP_002082716.1 DUF3937 domain-containing protein -
  ABM478_RS12735 - 2499760..2500071 (+) 312 WP_001071365.1 heterocycloanthracin/sonorensin family bacteriocin -
  ABM478_RS12740 - 2500248..2500351 (+) 104 Protein_2428 site-specific integrase -
  ABM478_RS12745 - 2500561..2501046 (+) 486 WP_002041181.1 hypothetical protein -
  ABM478_RS12750 - 2501358..2502059 (+) 702 WP_349917140.1 DUF3962 domain-containing protein -
  ABM478_RS12755 - 2502098..2503207 (-) 1110 WP_349917142.1 tyrosine-type recombinase/integrase -
  ABM478_RS12760 - 2503412..2503594 (+) 183 WP_349917144.1 hypothetical protein -
  ABM478_RS12765 - 2503966..2505174 (+) 1209 WP_318160692.1 AimR family lysis-lysogeny pheromone receptor -
  ABM478_RS12770 - 2505201..2505356 (+) 156 WP_000791664.1 hypothetical protein -
  ABM478_RS12775 - 2505617..2505967 (-) 351 WP_146718789.1 helix-turn-helix transcriptional regulator -
  ABM478_RS12780 - 2506151..2506405 (+) 255 WP_146718788.1 helix-turn-helix transcriptional regulator -
  ABM478_RS12785 - 2506504..2506605 (+) 102 Protein_2437 ORF6C domain-containing protein -
  ABM478_RS12790 - 2506664..2506930 (+) 267 WP_000522024.1 helix-turn-helix domain-containing protein -
  ABM478_RS12795 - 2506930..2507094 (+) 165 WP_000390298.1 hypothetical protein -
  ABM478_RS12800 - 2507124..2507300 (+) 177 WP_001241130.1 hypothetical protein -
  ABM478_RS12805 - 2507305..2508051 (+) 747 WP_349917148.1 DnaD domain protein -
  ABM478_RS12810 - 2507990..2508865 (+) 876 WP_349917150.1 ATP-binding protein -
  ABM478_RS12815 - 2508881..2509075 (+) 195 WP_069354846.1 hypothetical protein -
  ABM478_RS12820 abrB 2509092..2509370 (+) 279 WP_146719285.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  ABM478_RS12825 - 2509363..2509722 (+) 360 WP_146719286.1 cell division protein SepF -
  ABM478_RS12830 - 2509742..2509909 (+) 168 WP_146719287.1 DUF3954 domain-containing protein -
  ABM478_RS12835 - 2509935..2510135 (+) 201 WP_146719288.1 helix-turn-helix domain containing protein -
  ABM478_RS12840 - 2510206..2510661 (+) 456 WP_146719289.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  ABM478_RS12845 - 2511021..2511398 (-) 378 WP_113305001.1 YxeA family protein -
  ABM478_RS12850 - 2512593..2513762 (+) 1170 WP_349917155.1 hypothetical protein -
  ABM478_RS12855 - 2514212..2514898 (-) 687 WP_065212696.1 CPBP family glutamic-type intramembrane protease -
  ABM478_RS12860 - 2515519..2516175 (+) 657 WP_139846802.1 hypothetical protein -
  ABM478_RS12865 - 2516334..2516504 (+) 171 WP_172605309.1 hypothetical protein -
  ABM478_RS12870 - 2516532..2517014 (+) 483 WP_074047971.1 ArpU family phage packaging/lysis transcriptional regulator -
  ABM478_RS12875 - 2517014..2517556 (+) 543 WP_065212693.1 site-specific integrase -
  ABM478_RS12880 - 2517770..2518720 (+) 951 WP_130813796.1 nucleoside hydrolase -
  ABM478_RS12885 - 2519085..2520023 (+) 939 WP_349917159.1 hypothetical protein -
  ABM478_RS12890 - 2520223..2521479 (-) 1257 WP_349917161.1 hypothetical protein -
  ABM478_RS12895 - 2521510..2521686 (+) 177 WP_167320414.1 hypothetical protein -
  ABM478_RS12900 - 2522057..2522239 (+) 183 WP_349917164.1 hypothetical protein -
  ABM478_RS12905 - 2522205..2522540 (+) 336 WP_349917166.1 HNH endonuclease -
  ABM478_RS12910 - 2522693..2523028 (+) 336 WP_000124848.1 P27 family phage terminase small subunit -
  ABM478_RS12915 - 2523025..2524683 (+) 1659 WP_349917168.1 terminase TerL endonuclease subunit -
  ABM478_RS12920 - 2524749..2525855 (+) 1107 WP_086400969.1 phage portal protein -
  ABM478_RS12925 - 2525839..2526615 (+) 777 WP_086400965.1 head maturation protease, ClpP-related -
  ABM478_RS12930 - 2526635..2527798 (+) 1164 WP_098213917.1 phage major capsid protein -
  ABM478_RS12935 - 2527811..2528104 (+) 294 WP_086401727.1 hypothetical protein -
  ABM478_RS12940 - 2528106..2528459 (+) 354 WP_061457257.1 phage head closure protein -
  ABM478_RS12945 - 2528461..2528802 (+) 342 WP_349917172.1 HK97 gp10 family phage protein -
  ABM478_RS12950 - 2528802..2529131 (+) 330 WP_166572199.1 hypothetical protein -
  ABM478_RS12955 - 2529132..2529719 (+) 588 WP_086401729.1 major tail protein -
  ABM478_RS12960 - 2529724..2530086 (+) 363 WP_086401730.1 hypothetical protein -
  ABM478_RS12965 - 2530317..2533937 (+) 3621 WP_166572200.1 DUF2207 domain-containing protein -
  ABM478_RS12970 - 2533979..2535442 (+) 1464 WP_349917176.1 distal tail protein Dit -
  ABM478_RS12975 - 2535439..2539962 (+) 4524 WP_349917178.1 phage tail spike protein -
  ABM478_RS12980 - 2539978..2540340 (+) 363 WP_271143461.1 hypothetical protein -
  ABM478_RS12985 - 2540378..2540662 (+) 285 WP_000435483.1 hypothetical protein -
  ABM478_RS12990 - 2540677..2540907 (+) 231 WP_001243443.1 phage holin -
  ABM478_RS12995 - 2540924..2541634 (+) 711 WP_349917180.1 N-acetylmuramoyl-L-alanine amidase -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10021.61 Da        Isoelectric Point: 6.7189

>NTDB_id=1008477 ABM478_RS12820 WP_146719285.1 2509092..2509370(+) (abrB) [Bacillus cereus strain B9]
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALGFHVEGENIVLRKHDKSCFVTGEVSESNMELLGGRIFLSKEGAIEL
LDFIQKSGMAHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=1008477 ABM478_RS12820 WP_146719285.1 2509092..2509370(+) (abrB) [Bacillus cereus strain B9]
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAACTAGGGCGAGTGGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
AATTGCTGAAGGTACAGCATTAGGCTTTCATGTTGAAGGGGAAAACATTGTTTTAAGAAAACATGACAAGTCATGCTTTG
TAACTGGTGAAGTTTCTGAATCGAACATGGAATTGCTAGGTGGCCGAATATTTTTGAGTAAGGAAGGGGCAATTGAATTA
CTGGATTTTATTCAGAAGAGTGGGATGGCACATGCCTAA

Domains

Predicted by InterproScan.

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-48)

AbrB C-terminal domain (AbrB_C)

(52-86)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

59.77

94.565

0.565

Multiple sequence alignment