Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   ABL163_RS11720 Genome accession   NZ_CP157671
Coordinates   2440242..2440679 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain TZ01     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2435242..2445679
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABL163_RS11670 sinI 2435625..2435798 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  ABL163_RS11675 sinR 2435832..2436167 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ABL163_RS11680 - 2436215..2437000 (-) 786 WP_032874027.1 TasA family protein -
  ABL163_RS11685 - 2437065..2437649 (-) 585 WP_032874025.1 signal peptidase I -
  ABL163_RS11690 tapA 2437621..2438292 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  ABL163_RS11695 - 2438551..2438880 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  ABL163_RS11700 - 2438921..2439100 (-) 180 WP_022552966.1 YqzE family protein -
  ABL163_RS11705 comGG 2439157..2439534 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABL163_RS11710 comGF 2439535..2440035 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  ABL163_RS11715 comGE 2439944..2440258 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  ABL163_RS11720 comGD 2440242..2440679 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  ABL163_RS11725 comGC 2440669..2440935 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  ABL163_RS11730 comGB 2440982..2442019 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  ABL163_RS11735 comGA 2442006..2443076 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ABL163_RS11740 - 2443273..2444223 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -
  ABL163_RS11745 - 2444369..2445670 (+) 1302 WP_032874010.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=1007986 ABL163_RS11720 WP_007612572.1 2440242..2440679(-) (comGD) [Bacillus velezensis strain TZ01]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=1007986 ABL163_RS11720 WP_007612572.1 2440242..2440679(-) (comGD) [Bacillus velezensis strain TZ01]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCATATTACACTTGTAACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATAACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559


Multiple sequence alignment