Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   FJH52_RS02670 Genome accession   NZ_LR595848
Coordinates   522983..523132 (+) Length   49 a.a.
NCBI ID   WP_001813641.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain 4559 isolate 4559     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 517983..528132
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FJH52_RS02635 blpU 519847..520077 (+) 231 WP_001093268.1 bacteriocin-like peptide BlpU -
  FJH52_RS02640 - 520080..520199 (+) 120 WP_000346298.1 PncF family bacteriocin immunity protein -
  FJH52_RS02645 - 520496..520660 (+) 165 WP_000727118.1 hypothetical protein -
  FJH52_RS02650 - 520657..521061 (+) 405 WP_000846944.1 hypothetical protein -
  FJH52_RS02655 - 521259..522064 (+) 806 Protein_532 IS5 family transposase -
  FJH52_RS02660 blpM 522266..522520 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  FJH52_RS02665 blpN 522536..522739 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  FJH52_RS02670 cipB 522983..523132 (+) 150 WP_001813641.1 bacteriocin-like peptide BlpO Regulator
  FJH52_RS02675 - 523236..523355 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  FJH52_RS02680 - 524141..524524 (+) 384 WP_000877378.1 hypothetical protein -
  FJH52_RS02685 - 524576..525265 (+) 690 WP_000760541.1 CPBP family intramembrane glutamic endopeptidase -
  FJH52_RS02690 blpZ 525307..525540 (+) 234 WP_000276498.1 immunity protein BlpZ -
  FJH52_RS02695 - 525691..526302 (+) 612 WP_000394045.1 CPBP family intramembrane glutamic endopeptidase -
  FJH52_RS02700 ccrZ 526463..527257 (+) 795 WP_127820893.1 cell cycle regulator CcrZ -
  FJH52_RS02705 trmB 527254..527889 (+) 636 WP_001266078.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5164.93 Da        Isoelectric Point: 3.9133

>NTDB_id=1006256 FJH52_RS02670 WP_001813641.1 522983..523132(+) (cipB) [Streptococcus pneumoniae strain 4559 isolate 4559]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=1006256 FJH52_RS02670 WP_001813641.1 522983..523132(+) (cipB) [Streptococcus pneumoniae strain 4559 isolate 4559]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-41)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

48.98

100

0.49