Detailed information    

insolico Bioinformatically predicted

Overview

Name   comE/comE2   Type   Regulator
Locus tag   FGL05_RS09570 Genome accession   NZ_LR594044
Coordinates   195290..195418 (+) Length   42 a.a.
NCBI ID   WP_260665384.1    Uniprot ID   -
Organism   Streptococcus lutetiensis strain NCTC8796     
Function   activate transcription of early competence genes (predicted from homology)   
Competence regulation

Genomic Context

Location: 190290..200418
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FGL05_RS00950 (NCTC8796_00202) rsmA 190333..191205 (+) 873 WP_021143191.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
  FGL05_RS00955 - 191612..191761 (+) 150 WP_020917491.1 hypothetical protein -
  FGL05_RS00960 (NCTC8796_00203) - 191774..192079 (+) 306 WP_020917490.1 bacteriocin immunity protein -
  FGL05_RS00965 (NCTC8796_00204) - 192107..192400 (+) 294 WP_020917489.1 bacteriocin immunity protein -
  FGL05_RS00970 (NCTC8796_00206) comD/comD2 193317..194129 (+) 813 WP_171009914.1 GHKL domain-containing protein Regulator
  FGL05_RS09260 (NCTC8796_00207) comE/comE2 194687..194914 (+) 228 WP_233422877.1 hypothetical protein Regulator
  FGL05_RS09565 (NCTC8796_00208) comE/comE2 194899..195279 (+) 381 WP_267895290.1 LytTR family transcriptional regulator DNA-binding domain-containing protein Regulator
  FGL05_RS09570 comE/comE2 195290..195418 (+) 129 WP_260665384.1 LytTR family transcriptional regulator DNA-binding domain-containing protein Regulator
  FGL05_RS00985 (NCTC8796_00210) rsgA 195736..196608 (+) 873 WP_058832824.1 ribosome small subunit-dependent GTPase A -
  FGL05_RS00990 (NCTC8796_00211) rpe 196615..197277 (+) 663 WP_020917487.1 ribulose-phosphate 3-epimerase -
  FGL05_RS00995 (NCTC8796_00212) - 197270..197902 (+) 633 WP_020917486.1 thiamine diphosphokinase -
  FGL05_RS01000 (NCTC8796_00213) - 197904..199178 (+) 1275 WP_020917485.1 DNA recombination protein RmuC -
  FGL05_RS01005 (NCTC8796_00214) - 199168..200106 (+) 939 WP_020917484.1 3'-5' exoribonuclease YhaM family protein -

Sequence

Protein


Download         Length: 42 a.a.        Molecular weight: 5067.91 Da        Isoelectric Point: 9.5746

>NTDB_id=1005622 FGL05_RS09570 WP_260665384.1 195290..195418(+) (comE/comE2) [Streptococcus lutetiensis strain NCTC8796]
MNLNNIVRLDKKEGLVYFDDDKACYVSRKYIKDLRSKMENLK

Nucleotide


Download         Length: 129 bp        

>NTDB_id=1005622 FGL05_RS09570 WP_260665384.1 195290..195418(+) (comE/comE2) [Streptococcus lutetiensis strain NCTC8796]
ATTAACCTAAATAATATTGTTAGGTTAGATAAAAAAGAAGGTTTGGTTTATTTTGACGATGATAAAGCTTGTTATGTTTC
TAGAAAATATATCAAAGACTTAAGGTCAAAAATGGAAAATCTGAAATAG

Domains

Predicted by InterProScan.

LytTr DNA-binding domain (LytTR)

(2-38)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/comE2 Streptococcus equinus JB1

97.619

100

0.976