Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ABI226_RS13375 | Genome accession | NZ_CP157216 |
| Coordinates | 2556680..2556853 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis isolate FELIX_MS22 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2551680..2561853
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABI226_RS13360 (ABI226_13360) | gcvT | 2552479..2553567 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ABI226_RS13365 (ABI226_13365) | yqhH | 2554009..2555682 (+) | 1674 | WP_004398544.1 | SNF2-related protein | - |
| ABI226_RS13370 (ABI226_13370) | yqhG | 2555703..2556497 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| ABI226_RS13375 (ABI226_13375) | sinI | 2556680..2556853 (+) | 174 | WP_003230187.1 | anti-repressor SinI family protein | Regulator |
| ABI226_RS13380 (ABI226_13380) | sinR | 2556887..2557222 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| ABI226_RS13385 (ABI226_13385) | tasA | 2557315..2558100 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| ABI226_RS13390 (ABI226_13390) | sipW | 2558164..2558736 (-) | 573 | WP_003246088.1 | signal peptidase I | - |
| ABI226_RS13395 (ABI226_13395) | tapA | 2558720..2559481 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ABI226_RS13400 (ABI226_13400) | yqzG | 2559753..2560079 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| ABI226_RS13405 (ABI226_13405) | spoIIT | 2560121..2560300 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| ABI226_RS13410 (ABI226_13410) | comGG | 2560371..2560745 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| ABI226_RS13415 (ABI226_13415) | comGF | 2560746..2561129 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| ABI226_RS13420 (ABI226_13420) | comGE | 2561155..2561502 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=1004840 ABI226_RS13375 WP_003230187.1 2556680..2556853(+) (sinI) [Bacillus subtilis subsp. subtilis isolate FELIX_MS22]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1004840 ABI226_RS13375 WP_003230187.1 2556680..2556853(+) (sinI) [Bacillus subtilis subsp. subtilis isolate FELIX_MS22]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |