Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ABGT19_RS16165 Genome accession   NZ_CP156993
Coordinates   3011267..3011407 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain AR03-27     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3006267..3016407
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABGT19_RS16145 (ABGT19_16145) - 3008397..3009521 (+) 1125 WP_031601042.1 IS4-like element IS4Bsu1 family transposase -
  ABGT19_RS16150 (ABGT19_16150) - 3009651..3009980 (-) 330 WP_322808282.1 hypothetical protein -
  ABGT19_RS16155 (ABGT19_16155) comX 3009996..3010217 (-) 222 WP_014480704.1 competence pheromone ComX -
  ABGT19_RS16160 (ABGT19_16160) - 3010219..3011082 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  ABGT19_RS16165 (ABGT19_16165) degQ 3011267..3011407 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ABGT19_RS16170 (ABGT19_16170) - 3011629..3011754 (+) 126 WP_003228793.1 hypothetical protein -
  ABGT19_RS16175 (ABGT19_16175) - 3011868..3012236 (+) 369 WP_014477834.1 hypothetical protein -
  ABGT19_RS16180 (ABGT19_16180) pdeH 3012212..3013441 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  ABGT19_RS16185 (ABGT19_16185) pncB 3013577..3015049 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  ABGT19_RS16190 (ABGT19_16190) pncA 3015065..3015616 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  ABGT19_RS16195 (ABGT19_16195) yueI 3015713..3016111 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1003733 ABGT19_RS16165 WP_003220708.1 3011267..3011407(-) (degQ) [Bacillus subtilis strain AR03-27]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1003733 ABGT19_RS16165 WP_003220708.1 3011267..3011407(-) (degQ) [Bacillus subtilis strain AR03-27]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment