Detailed information NTG1002173

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: ABFY44_RS11715
• Genome accession: NZ_CP156684
• Coordinates: 2440300..2440737 (-)
• Length: 145 a.a.
• NCBI ID: WP_007612572.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain D83
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2435300..2445737

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ABFY44_RS11665 (ABFY44_11665)	sinI	2435683..2435856 (+)	174	WP_032874029.1	anti-repressor SinI family protein	Regulator
ABFY44_RS11670 (ABFY44_11670)	sinR	2435890..2436225 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
ABFY44_RS11675 (ABFY44_11675)	-	2436273..2437058 (-)	786	WP_032874027.1	TasA family protein	-
ABFY44_RS11680 (ABFY44_11680)	-	2437123..2437707 (-)	585	WP_032874025.1	signal peptidase I	-
ABFY44_RS11685 (ABFY44_11685)	tapA	2437679..2438350 (-)	672	WP_032874023.1	amyloid fiber anchoring/assembly protein TapA	-
ABFY44_RS11690 (ABFY44_11690)	-	2438609..2438938 (+)	330	WP_032874021.1	DUF3889 domain-containing protein	-
ABFY44_RS11695 (ABFY44_11695)	-	2438979..2439158 (-)	180	WP_022552966.1	YqzE family protein	-
ABFY44_RS11700 (ABFY44_11700)	comGG	2439215..2439592 (-)	378	WP_032874019.1	competence type IV pilus minor pilin ComGG	Machinery gene
ABFY44_RS11705 (ABFY44_11705)	comGF	2439593..2440093 (-)	501	WP_223204419.1	competence type IV pilus minor pilin ComGF	-
ABFY44_RS11710 (ABFY44_11710)	comGE	2440002..2440316 (-)	315	WP_032874016.1	competence type IV pilus minor pilin ComGE	Machinery gene
ABFY44_RS11715 (ABFY44_11715)	comGD	2440300..2440737 (-)	438	WP_007612572.1	competence type IV pilus minor pilin ComGD	Machinery gene
ABFY44_RS11720 (ABFY44_11720)	comGC	2440727..2441035 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
ABFY44_RS11725 (ABFY44_11725)	comGB	2441040..2442077 (-)	1038	WP_032874014.1	competence type IV pilus assembly protein ComGB	Machinery gene
ABFY44_RS11730 (ABFY44_11730)	comGA	2442064..2443134 (-)	1071	WP_003153083.1	competence type IV pilus ATPase ComGA	Machinery gene
ABFY44_RS11735 (ABFY44_11735)	-	2443331..2444281 (-)	951	WP_032874012.1	magnesium transporter CorA family protein	-
ABFY44_RS11740 (ABFY44_11740)	-	2444427..2445728 (+)	1302	WP_032874010.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16254.76 Da
• Isoelectric Point: 10.1850

>NTDB_id=1002173 ABFY44_RS11715 WP_007612572.1 2440300..2440737(-) (comGD) [Bacillus velezensis strain D83]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1002173 ABFY44_RS11715 WP_007612572.1 2440300..2440737(-) (comGD) [Bacillus velezensis strain D83]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCATATTACACTTGTAACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATAACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	55.479	100	0.559