Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   ABFY42_RS01960 Genome accession   NZ_CP156682
Coordinates   389659..389778 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain B115     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 384659..394778
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABFY42_RS01945 (ABFY42_01945) - 386271..386954 (+) 684 WP_022552587.1 response regulator transcription factor -
  ABFY42_RS01950 (ABFY42_01950) - 386941..388368 (+) 1428 WP_089072406.1 HAMP domain-containing sensor histidine kinase -
  ABFY42_RS01955 (ABFY42_01955) rapC 388527..389675 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  ABFY42_RS01960 (ABFY42_01960) phrC 389659..389778 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ABFY42_RS01965 (ABFY42_01965) - 389930..390025 (-) 96 WP_021495118.1 YjcZ family sporulation protein -
  ABFY42_RS01970 (ABFY42_01970) - 390120..391484 (-) 1365 WP_021495117.1 aspartate kinase -
  ABFY42_RS01975 (ABFY42_01975) ceuB 391898..392851 (+) 954 WP_014416904.1 ABC transporter permease Machinery gene
  ABFY42_RS01980 (ABFY42_01980) - 392841..393788 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  ABFY42_RS01985 (ABFY42_01985) - 393782..394540 (+) 759 WP_022552588.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1002063 ABFY42_RS01960 WP_003156334.1 389659..389778(+) (phrC) [Bacillus velezensis strain B115]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1002063 ABFY42_RS01960 WP_003156334.1 389659..389778(+) (phrC) [Bacillus velezensis strain B115]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment