Detailed information NTG1001857

Bioinformatically predicted

Overview

• Name: cipB
• Type: Regulator
• Locus tag: ABC807_RS08420
• Genome accession: NZ_CP156625
• Coordinates: 1618828..1618977 (-)
• Length: 49 a.a.
• NCBI ID: WP_001809846.1
• Uniprot ID: Q00MV6
• Organism: Streptococcus pneumoniae strain TL7/1993
• Function: indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IScluster/Tn	1614744..1620648	1618828..1618977	within	0

Gene organization within MGE regions

Location: 1614744..1620648

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ABC807_RS08395 (ABC807_08395)	-	1614744..1616090 (-)	1347	WP_025168898.1	IS1380-like element ISSpn5 family transposase	-
ABC807_RS08400 (ABC807_08400)	blpZ	1616421..1616654 (-)	234	WP_000276498.1	immunity protein BlpZ	-
ABC807_RS08405 (ABC807_08405)	-	1616696..1617385 (-)	690	WP_000760521.1	CPBP family intramembrane glutamic endopeptidase	-
ABC807_RS08410 (ABC807_08410)	-	1617400..1617819 (-)	420	WP_000877385.1	hypothetical protein	-
ABC807_RS08415 (ABC807_08415)	-	1618605..1618724 (-)	120	WP_000346296.1	PncF family bacteriocin immunity protein	-
ABC807_RS08420 (ABC807_08420)	cipB	1618828..1618977 (-)	150	WP_001809846.1	bacteriocin-like peptide BlpO	Regulator
ABC807_RS08425 (ABC807_08425)	blpN	1619221..1619424 (-)	204	WP_001099492.1	two-peptide bacteriocin subunit BlpN	-
ABC807_RS08430 (ABC807_08430)	blpM	1619440..1619694 (-)	255	WP_000379879.1	two-peptide bacteriocin subunit BlpM	-
ABC807_RS08435 (ABC807_08435)	-	1619844..1620648 (-)	805	Protein_1620	IS5 family transposase	-

Sequence

Protein

• Length: 49 a.a.
• Molecular weight: 5149.92 Da
• Isoelectric Point: 4.0439

>NTDB_id=1001857 ABC807_RS08420 WP_001809846.1 1618828..1618977(-) (cipB) [Streptococcus pneumoniae strain TL7/1993]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide

• Length: 150 bp

>NTDB_id=1001857 ABC807_RS08420 WP_001809846.1 1618828..1618977(-) (cipB) [Streptococcus pneumoniae strain TL7/1993]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

• Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc) (6-44)

3D structure

• AlphaFold DB: Q00MV6

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
cipB	Streptococcus mutans UA159	53.061	100	0.531