Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   EL130_RS03930 Genome accession   NZ_LR134320
Coordinates   760831..761061 (+) Length   76 a.a.
NCBI ID   WP_002275977.1    Uniprot ID   Q8DVP7
Organism   Streptococcus mutans strain NCTC10832     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 755831..766061
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EL130_RS03910 (NCTC10832_00741) rnpM 756406..756702 (+) 297 WP_002263922.1 RNase P modulator RnpM -
  EL130_RS03915 (NCTC10832_00742) - 756695..756997 (+) 303 WP_002262601.1 YlxQ-related RNA-binding protein -
  EL130_RS10465 - 757018..757113 (+) 96 Protein_694 translation initiation factor IF-2 N-terminal domain-containing protein -
  EL130_RS03920 (NCTC10832_00743) infB 757546..759768 (+) 2223 Protein_695 translation initiation factor IF-2 -
  EL130_RS03925 (NCTC10832_00744) rbfA 760002..760352 (+) 351 WP_002262599.1 30S ribosome-binding factor RbfA -
  EL130_RS03930 (NCTC10832_00746) cipB 760831..761061 (+) 231 WP_002275977.1 bacteriocin class II family protein Regulator
  EL130_RS03935 (NCTC10832_00747) - 761452..761895 (+) 444 WP_002283491.1 CopY/TcrY family copper transport repressor -
  EL130_RS03940 (NCTC10832_00748) - 761892..764120 (+) 2229 WP_002267008.1 heavy metal translocating P-type ATPase -
  EL130_RS03945 (NCTC10832_00749) copZ 764133..764336 (+) 204 WP_002264873.1 copper chaperone CopZ -
  EL130_RS03950 (NCTC10832_00750) - 764583..765404 (+) 822 WP_032523117.1 Cof-type HAD-IIB family hydrolase -
  EL130_RS03955 (NCTC10832_00751) - 765511..766032 (-) 522 WP_002275391.1 YgjV family protein -

Sequence

Protein


Download         Length: 76 a.a.        Molecular weight: 7229.19 Da        Isoelectric Point: 3.7781

>NTDB_id=1001565 EL130_RS03930 WP_002275977.1 760831..761061(+) (cipB) [Streptococcus mutans strain NCTC10832]
MNTQAFEQFNVMDNEALSTVEGGGMIRCALGTAGSAGLGFVGGMGAGTVTLPVVGTVSGAALGGWSGAAVGAATFC

Nucleotide


Download         Length: 231 bp        

>NTDB_id=1001565 EL130_RS03930 WP_002275977.1 760831..761061(+) (cipB) [Streptococcus mutans strain NCTC10832]
ATGAATACACAAGCATTTGAACAATTTAACGTAATGGATAATGAAGCACTTTCAACTGTTGAGGGTGGTGGTATGATTAG
ATGTGCACTTGGCACAGCTGGTTCTGCAGGTTTAGGATTTGTAGGGGGTATGGGAGCTGGTACAGTTACTCTCCCAGTCG
TTGGTACAGTATCTGGAGCGGCTTTAGGAGGCTGGTCTGGAGCAGCTGTAGGTGCTGCTACTTTTTGTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-70)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q8DVP7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

71.429

55.263

0.395

Multiple sequence alignment