Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   101030
Name   oriT_pKS1030-3 experimental
Organism   Staphylococcus equorum strain KS1030
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP068579 (2941..3041 [+], 101 nt)
oriT length   101 nt
IRs (inverted repeats)      IR1: 27..32, 51..56  (TGTGCC..GGCACA)
  IR2: 36..39, 45..48  (TTTC..GAAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   

  oriT sequence  


Download         Length: 101 nt

>oriT_pKS1030-3
TCTTCTGCCGAAACTTTGAATATGAGTGTGCCGACTTTCGTTAAGAAAAAGGCACATGGGAGTCGATTGGTAGCGCCCAAATTAGATAAAGAGACGCGACA

Visualization of oriT structure (The oriT was characterized experimentally)

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Sojeong Heo et al. (2023) Staphylococcus equorum plasmid pKS1030-3 encodes auxiliary biofilm formation and trans-acting gene mobilization systems. Scientific reports. 13(1):11108. [PMID:37429971]


Relaxosome

This oriT is a component of a relaxosome.

Relaxosome name   RelaxosomepKS1030-3 in_silico
oriT   oriT_pKS1030-3 experimental
Relaxase   Rlx_pKS1030-3 experimental (MOBP)
Auxiliary protein   MobC_pKS1030-3 experimental

  Reference


[1] Sojeong Heo et al. (2023) Staphylococcus equorum plasmid pKS1030-3 encodes auxiliary biofilm formation and trans-acting gene mobilization systems. Scientific reports. 13(1):11108. [PMID:37429971]


Relaxase

ID   1091 GenBank   WP_202809422
Name   Rlx_pKS1030-3 experimental UniProt ID   _
Length   319 a.a. PDB ID   
Note   

  Relaxase protein sequence


Download         Length: 319 a.a.        Molecular weight: 36748.72 Da        Isoelectric Point: 7.9257

>WP_202809422.1 relaxase/mobilization nuclease domain-containing protein [Staphylococcus equorum]
MATTKLGNTKSASRAINYAEKRAEEKSGLNCDVDYAKSAFKATRALYGKEDGIQAHTVIQSFKPGEVTPE
QCNQIGLELAEKIAPNHQVAVYTHTDKDHYHNHIVINSIDLDTGKKYQSNKKQREFVKQANDTLCHAHGL
SVPEKQRETRYTQAEYEIGKEAQKGNKPIPWKEQIRMVIDQTQATNHEELNQDLLQNGMKIERITEKTIT
YKHLEEDKKVRGSKLGEEYDKGGLEHGYDGRIKSREQENTRETGPDRKATQSEWDNFADNTRKLEHDRRS
SEAARLAHEKSIRDKEEREREREQAQRTSKKSRGFDLEL

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(8-238)


  Protein structure



No available structure.



  Reference


[1] Sojeong Heo et al. (2023) Staphylococcus equorum plasmid pKS1030-3 encodes auxiliary biofilm formation and trans-acting gene mobilization systems. Scientific reports. 13(1):11108. [PMID:37429971]


Host bacterium

ID   1492 GenBank   NZ_CP068579
Plasmid name   pKS1030-3 Incompatibility group   -
Plasmid size   13583 bp Coordinate of oriT [Strand]   2941..3041 [+]
Host baterium   Staphylococcus equorum strain KS1030

Cargo genes

Drug resistance gene   -
Virulence gene   icaA
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -