Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 101027 |
Name | oriT_pCW3 |
Organism | Clostridium perfringens |
Sequence Completeness | core |
NCBI accession of oriT (coordinates [strand]) | NC_010937 (24697..24846 [+], 150 nt) |
oriT length | 150 nt |
IRs (inverted repeats) | _ |
Location of nic site | _ |
Conserved sequence flanking the nic site |
_ |
Note |
oriT sequence
Download Length: 150 nt
AAGGAACTTTACAGGGAACTTTAAAAATTTAAATTGATATAAAAGTTCCCTGTATTAGTATAAGTATTTTAAAGGTATATATCATTATTAGTTCCTTATCGTATTATAGAGTATATATTATATATATAATATATACATATAATGTATTGG
oriT secondary structure
Predicted by RNAfold.
Download structure fileReference
[1] Jessica A Wisniewski et al. (2016) TcpM: a novel relaxase that mediates transfer of large conjugative plasmids from Clostridium perfringens. Molecular microbiology. 99(5):884-96. [PMID:26560080]
Relaxosome
This oriT is a component of a relaxosome.
Relaxosome name | RelaxosomepCW3 |
oriT | oriT_pCW3 |
Relaxase | TcpM_pCW3 (_) |
Auxiliary protein | TcpK_pCW3 |
Reference
[1] Daouda A K Traore et al. (2018) Crystal structure of TcpK in complex with oriT DNA of the antibiotic resistance plasmid pCW3. Nature communications. 9(1):3732. [PMID:30213934]
[2] Jessica A Wisniewski et al. (2016) TcpM: a novel relaxase that mediates transfer of large conjugative plasmids from Clostridium perfringens. Molecular microbiology. 99(5):884-96. [PMID:26560080]
Relaxase
ID | 1085 | GenBank | WP_003479716 |
Name | TcpM_pCW3 | UniProt ID | Q1PLI1 |
Length | 266 a.a. | PDB ID | |
Note |
Relaxase protein sequence
Download Length: 266 a.a. Molecular weight: 31237.01 Da Isoelectric Point: 10.4048
MNIFNLKKEMKNIIYSDSSLSKNSIRDRNSALNKIFENFNNLDDVSVITKDKILDNLNSIKFKTKLSAGV
NAIRFLKGQNLDVDFPSEDELKEIIKNKKKNNRKPTVEKNLIDIERKVNRVRKKNYRLAYKLMLESGLRV
HEVSALKKEDFSFDKNLITINLREAKGNKLCSIELENKYLSKNISEFVETKSEDERVFPHMRYLQEQATK
MGIKCHDLRRGFAKRTYKEELENDSPRSEALDKTRIKLRHTRSDTTKIYLNSKIKV
Protein domains
Predicted by InterproScan.
Protein structure
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q1PLI1 |
Reference
[1] Jessica A Wisniewski et al. (2016) TcpM: a novel relaxase that mediates transfer of large conjugative plasmids from Clostridium perfringens. Molecular microbiology. 99(5):884-96. [PMID:26560080]
Auxiliary protein
ID | 389 | GenBank | WP_003458874 |
Name | TcpK_pCW3 | UniProt ID | Q1PLI2 |
Length | 102 a.a. | PDB ID | 5VFY |
Note |
Auxiliary protein sequence
Download Length: 102 a.a. Molecular weight: 12420.45 Da Isoelectric Point: 9.1608
MKDLNLYAKELVDVVNYLMKKNQLVFSRNNKFIYVNTETIKSMLEKRNYDTVDGKLYLWRELEWIECAED
RFNKRIKIDGENMYAVVIKYSSYSILKRLYLE
Protein domains
Predicted by InterproScan.
Protein structure
Source | ID | Structure |
---|---|---|
PDB | 5VFY | |
AlphaFold DB | Q1PLI2 |
Reference
[1] Daouda A K Traore et al. (2018) Crystal structure of TcpK in complex with oriT DNA of the antibiotic resistance plasmid pCW3. Nature communications. 9(1):3732. [PMID:30213934]
Host bacterium
ID | 1490 | GenBank | NC_010937 |
Plasmid name | pCW3 | Incompatibility group | - |
Plasmid size | 47263 bp | Coordinate of oriT [Strand] | 24697..24846 [+] |
Host baterium | Clostridium perfringens |
Cargo genes
Drug resistance gene | tetA(P), tetB(P) |
Virulence gene | cna |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | AcrIIA7 |