Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 100179 |
Name | oriT_pC221 |
Organism | Staphylococcus aureus |
Sequence Completeness | core |
NCBI accession of oriT (coordinates [strand]) | NC_006977 (3084..3160 [+], 77 nt) |
oriT length | 77 nt |
IRs (inverted repeats) | |
Location of nic site | 67..68 |
Conserved sequence flanking the nic site |
|
Note | _ |
oriT sequence
Download Length: 77 nt
GGGTATGGGATATAATCCCATCAAGCCGGTATATTCAGAACGAAGTGGCTAGAATATACAACGCTTGCCAAACCACA
Visualization of oriT structure (The oriT was characterized experimentally)
oriT secondary structure
Predicted by RNAfold.
Download structure fileReference
[1] Varsaki A et al. (2009) Analysis of ColE1 MbeC unveils an extended ribbon-helix-helix family of nicking accessory proteins. J Bacteriol. 191(5):1446-55. [PMID:19114496]
[2] Caryl JA et al. (2006) Investigating the basis of substrate recognition in the pC221 relaxosome. Mol Microbiol . 60(5):1302-18. [PMID:16689804]
Relaxosome
This oriT is a component of a relaxosome.
Relaxosome name | RelaxosomepC221 |
oriT | oriT_pC221 |
Relaxase | MobA_pC221 (_) |
Auxiliary protein | mobB_pC221 , mobC_pC221 |
Reference
[1] Caryl JA et al. (2006) Investigating the basis of substrate recognition in the pC221 relaxosome. Mol Microbiol . 60(5):1302-18. [PMID:16689804]
[2] Smith MC et al. (2004) An accessory protein is required for relaxosome formation by small Staphylococcal plasmids. J Bacteriol. 186(11):3363-73. [PMID:15150221]
[3] Jamie A Caryl et al. (2004) Reconstitution of a staphylococcal plasmid-protein relaxation complex in vitro. Journal of bacteriology. 186(11):3374-83. [PMID:15150221]
Relaxase
ID | 172 | GenBank | WP_002493199 |
Name | MobA_pC221 | UniProt ID | P03865 |
Length | 315 a.a. | PDB ID | |
Note |
Relaxase protein sequence
Download Length: 315 a.a. Molecular weight: 36445.26 Da Isoelectric Point: 7.3757
MATTKLGNTKSASRAINYAEKRAEEKSGLNCDVDYAKSAFKQTRALYGKEDGIQAHTVIQSFKPGEVTPE
QCNQLGLELAEKIAPNHQVAVYTHTDKDHYHNHIVINSVDLETGKKYQSNKKQRDLVKKENDNICREHGL
SVTERGIAKMRYTQAEKGIVFDRDEYSWKDELRDLIENAKTHTSNLETFSEHLEEKGVGVKLRGETISYK
PENENKWVRGRTLGSEYEKGAIDHEHERHQKQQREPEYADEFKINWDAVEQHTEQLKQRRVERAQETKQA
HSKISSRDTRESENQRERAKGNNIRIERGDEGLSR
Protein domains
Predicted by InterproScan.
Protein structure
Source | ID | Structure |
---|---|---|
AlphaFold DB | P03865 |
Reference
[1] Caryl JA et al. (2006) Investigating the basis of substrate recognition in the pC221 relaxosome. Mol Microbiol . 60(5):1302-18. [PMID:16689804]
Auxiliary protein
ID | 396 | GenBank | P03866 |
Name | mobB_pC221 | UniProt ID | P03866 |
Length | 230 a.a. | PDB ID | _ |
Note |
Auxiliary protein sequence
Download Length: 230 a.a. Molecular weight: Da Isoelectric Point:
MRKGQLIMSMKDIKNNKENPNTQMNSKSTGTPSSSTQNSLNNEELSELKRQNKLIVKYLAEIQENQKIRE
KEQKEITSELKEATKDFRDKSLKIRNDFVDVLQEKLKHVDTEELKDILGRGIYKVREENDRMLQEVKRSH
EHYQTRQKYLFTGIGAMLLVFMLFALIMTIGSDFMSFLHVDTLQNAIAGKLKASEGFMTFVWYIAYGLPY
VLAIGLFIGLYEWIRAKFHD
Protein domains
No domain identified.
Protein structure
Source | ID | Structure |
---|---|---|
AlphaFold DB | P03866 |
ID | 397 | GenBank | WP_002489523 |
Name | mobC_pC221 | UniProt ID | _ |
Length | 127 a.a. | PDB ID | _ |
Note |
Auxiliary protein sequence
Download Length: 127 a.a. Molecular weight: 14626.32 Da Isoelectric Point: 8.8653
MSEYDNNLASDLSVGENRKPNRKEPKQISFRVSESEYEKLRSSAETLNMSVPNFVKKKAHGSRLVAPKFD
KETRQSIAKDLSKLGANVNQIAKYCNQHQHEAPNYEGLEHNINAVRERLDEIWQQLN
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
Host bacterium
ID | 172 | GenBank | NC_006977 |
Plasmid name | pC221 | Incompatibility group | - |
Plasmid size | 4555 bp | Coordinate of oriT [Strand] | 3084..3160 [+] |
Host baterium | Staphylococcus aureus |
Cargo genes
Drug resistance gene | cat(pC221) |
Virulence gene | - |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | - |