[1] Lee CA et al (2012) The Bacillus subtilis conjugative transposon ICEBs1 mobilizes plasmids lacking dedicated mobilization functions. J Bacteriol. 194(12):3165-72. [PMID:22505685] |
[2] Lee CA et al (2007) Identification of the origin of transfer (oriT) and DNA relaxase required for conjugation of the integrative and conjugative element ICEBs1 of Bacillus subtilis. J Bacteriol. 189(20):7254-61. [PMID:17693500] |
[3] Lee CA et al (2010) Autonomous plasmid-like replication of a conjugative transposon. Mol Microbiol. 75(2):268-79. [PMID:19943900] |
ID | 220 |
Name | YdcR (NicK)_ICEBs1 |
GenBank accession number | CAB12294 |
Family | MOBT |
Length | 352 aa |
UniProt ID | P96635 |
PDB ID | _ |
Pfam | Rep_trans [PF02486.18], Evalue: 1.60E-66, Aligned region: 126..327 |
Note | The ICEBs1 ydcR (nicK) gene product is homologous to the pT181 family of plasmid DNA relaxases. |
Protein sequence [Download] | MDELKQPPHANRGVVIVKEKNEAVESPLVSMVDYIRVSFKTHDVDRIIEEVLHLSKDFMT EKQSGFYGYVGTYELDYIKVFYSAPDDNRGVLIEMSGQGCRQFESFLECRKKTWYDFFQD CMQQGGSFTRFDLAIDDKKTYFSIPELLKKAQKGECISRFRKSDFNGSFDLSDGITGGTT IYFGSKKSEAYLCFYEKNYEQAEKYNIPLEELGDWNRYELRLKNERAQVAIDALLKTKDL TLIAMQIINNYVRFVDADENITREHWKTSLFWSDFIGDVGRLPLYVKPQKDFYQKSRNWL RNSCAPTMKMVLEADEHLGKTDLSDMIAEAELADKHKKMLDVYMADVADMVV |
[1] Lee CA et al (2012) The Bacillus subtilis conjugative transposon ICEBs1 mobilizes plasmids lacking dedicated mobilization functions. J Bacteriol. 194(12):3165-72. [PMID:22505685] |
[2] Lee CA et al (2007) Identification of the origin of transfer (oriT) and DNA relaxase required for conjugation of the integrative and conjugative element ICEBs1 of Bacillus subtilis. J Bacteriol. 189(20):7254-61. [PMID:17693500] |
[3] Lee CA et al (2010) Autonomous plasmid-like replication of a conjugative transposon. Mol Microbiol. 75(2):268-79. [PMID:19943900] |
# | ID | Name | GenBank | Length | Note |
1 | 308 | _ |
ID | 220 |
Name | YdcQ_ICEBs1 |
SecReT4 accesion number | _ |
GenBank accession number | CAB12293 |
Family | TrwB/TraD |
Length | 480 |
UniProt ID | P96634 |
PDB ID | _ |
Pfam | |
Note | putative coupling protein |
Protein sequence [Download] |
[1] Lee CA et al (2007) Autonomous plasmid-like replication of a conjugative transposon. J Bacteriol. 189(20):7254-61. [PMID:17693500] |
ID | 11 |
Element type | ICE (Conjugative transposon) |
ICE description | ICEBs1 |
ICEberg accesion number | 59 |
GenBank accession number | AL009126.3 |
Family | ICEBs1 |
Genome size | 20510 bp |
Coordinate of oriT [+/-] | 534790..534813 [+] |
Drug resistance | _ |
Heavy-metal resistance | _ |
Virulence factor | _ |
Xenobiotic degradation | _ |
Host bacterium [NCBI Taxonomy ID] | Bacillus subtilis subsp. subtilis str. 168 [224308] |
[1] Lee CA et al (2012) The Bacillus subtilis conjugative transposon ICEBs1 mobilizes plasmids lacking dedicated mobilization functions. J Bacteriol. 194(12):3165-72. [PMID:22505685] |