[1] Pansegrau W et al (1988) The origin of conjugative IncP plasmid transfer: interaction with plasmid-encoded products and the nucleotide sequence at the relaxation site. Biochim Biophys Acta. 951(2-3):365-74. [PMID:2850014] |
[2] Pansegrau W et al (1993) Relaxase (TraI) of IncP alpha plasmid RP4 catalyzes a site-specific cleaving-joining reaction of single-stranded DNA. Proc Natl Acad Sci U S A. 90(7):2925-9. [PMID:8385350] |
[3] Pansegrau W et al (1990) In vitro assembly of relaxosomes at the transfer origin of plasmid RP4. Proc Natl Acad Sci U S A. 87(17):6555-9. [PMID:2168553] |
[4] Cook DM et al (1992) The oriT region of the Agrobacterium tumefaciens Ti plasmid pTiC58 shares DNA sequence identity with the transfer origins of RSF1010 and RK2/RP4 and with T-region borders. J Bacteriol. 174(19):6238-46. [PMID:1400174] |
[5] Fürste JP et al (1989) Conjugative transfer of promiscuous IncP plasmids: interaction of plasmid-encoded products with the transfer origin. Proc Natl Acad Sci U S A. 86(6):1771-5. [PMID:2538813] |
[6] Dam B et al (2009) Conjugative Type 4 secretion system of a novel large plasmid from the chemoautotroph Tetrathiobacter kashmirensis and construction of shuttle vectors for Alcaligenaceae. Appl Environ Microbiol. 75(13):4362-73. [PMID:19411426] |
ID | 1 |
Name | TraI_RP4 |
GenBank accession number | CAA38336 |
Family | MOBP |
Length | 732 aa |
UniProt ID | Q00191 |
PDB ID | _ |
Pfam | Relaxase [PF03432.13], Evalue: 7.90E-67, Aligned region: 12..252 |
Note | relaxase; to recognize the conserved nick region sequence |
Protein sequence [Download] | MIAKHVPMRSIKKSDFAELVKYITDEQGKTERLGHVRVTNCEANTLPAVMAEVMATQHGN TRSEADKTYHLLVSFRAGEKPDAETLRAIEDRICAGLGFAEHQRVSAVHHDTDNLHIHIA INKIHPTRNTIHEPYRAYRALADLCATLERDYGLERDNHETRQRVSENRANDMERHAGVE SLVGWIKRECLPELQAAQSWEDLHRVLRENGLKLRERGNGFIFEAGDGTTVKASTVSRDL SKPKLEARFGAFTPAEGGEAPRRREYRAKPLKTRIDTTELYARYQSERQEMGAVRKGELD TLRRRRDRLIEAAMRSNRLRRAAIKLLGEGRIAKRLMYAQAHKALRADLDKINREYRQGR QAVQERTQRRAWADWLKAEAMKGDDKALAALRAREGRSDLKGNTIQGSGEAKPGHAAVTD NITKKGTIIYRVGSSAVRDDGDRLQVSREATTDGLDAALRLAMERFGDRITVNGTAEFKE RIAQAAAAGRLAITFDDAALERRRQELLTKEQAHEQPERNDGRRDRGGDGGIRPAAARTT LNATGGDGDRRDARAVSAGGTVALRKPNVGRIGRKPPPQSQNRLRALSQLGVVRIAGGAE MLLPRDVPGHVEQQGAEPAHALRRGVSGPGRGLKPEQIAAAEKYVAEREQKRLNGFDIPK HARYTDYVGALSYAGTRNVEDQALALLRKENDEILVLPVDKATVQRMKRLAIGDPVTVTP RGSLKTTRGRSR |
[1] Pansegrau W et al (1988) The origin of conjugative IncP plasmid transfer: interaction with plasmid-encoded products and the nucleotide sequence at the relaxation site. Biochim Biophys Acta. 951(2-3):365-74. [PMID:2850014] |
[2] Pansegrau W et al (1993) Relaxase (TraI) of IncP alpha plasmid RP4 catalyzes a site-specific cleaving-joining reaction of single-stranded DNA. Proc Natl Acad Sci U S A. 90(7):2925-9. [PMID:8385350] |
[3] Grahn AM et al (2000) Components of the RP4 Conjugative Transfer Apparatus Form an Envelope Structure Bridging Inner and Outer Membranes of Donor Cells: Implications for Related Macromolecule Transport Systems. J Bacteriol. 182(6):1564-74. [PMID:10692361] |
[4] Pansegrau W et al (1990) In vitro assembly of relaxosomes at the transfer origin of plasmid RP4. Proc Natl Acad Sci U S A. 87(17):6555-9. [PMID:2168553] |
# | ID | Name | GenBank | Length | Note |
1 | 1 | TraJ_RP4 | CAA38338 | 123 aa | to specifically bind to the nick site-proximal arm of the 19-bp inverted repeat sequence |
2 | 2 | TraH_RP4 | CAA38335 | 119 aa | The role of TraH is to stabilize the initialcomplex of form I oriT DNA, TraJ, and TraI by specific protein-protein interactions |
3 | 3 | TraK_RP4 | CAA38339 | 134 aa | TraK oriT binding protein |
ID | 1 |
Name | TraG_RP4 |
SecReT4 accesion number | _ |
GenBank accession number | CAA38334 |
Family | VirD4/TraG |
Length | 635 |
UniProt ID | Q00185 |
PDB ID | _ |
Pfam | T4SS-DNA_transf [PF02534.13], Evalue: 2.20E-174, Aligned region: 120..624 TraG-D_C [PF12696.6], Evalue: 2.70E-31, Aligned region: 443..568 TrwB_AAD_bind [PF10412.8], Evalue: 1.80E-23, Aligned region: 175..575 |
Note | conjugal transfer coupling protein TraG |
Protein sequence [Download] | MKNRNNAVGPQIRAKKPKASKTVPILAGLSLGAGLQTATQYFAHSFQYQAGLGWNINHVY TPWSILQWAGKWYGQYPDDFMRAASMGMVVSTVGLLGTAVTQMVKANTGKANDYLHGSAR WADKKDIQAAGLLPRPRTVVELVSGKHPPTSSGVYVGGWQDKDGKFHYLRHNGPEHVLTY APTRSGKGVGLVVPTLLSWAHSAVITDLKGELWALTAGWRKKHARNKVVRFEPASAQGSA CWNPLDEIRLGTEYEVGDVQNLATLIVDPDGKGLESHWQKTSQALLVGVILHALYKAKNE GTPATLPSVDGMLADPNRDVGELWMEMTTYGHVDGQNHPAVGSAARDMMDRPEEESGSVL STAKSYLALYRDPVVARNVSKSDFRIKQLMHHDDPVSLFIVTQPNDKARLRPLVRVMVNM IVRLLADKMDFENGRPVAHYKHRLLMMLDEFPSLGKLEILQESLAFVAGYGIKCYLICQD INQLKSRETGYGHDESITSNCHVQNAYPPNRVETAEHLSKLTGTTTIVKEQITTSGRRTS ALLGNVSRTFQEVQRPLLTPDECLRMPGPKKSADGSIEEAGDMVVYVAGYPAIYGKQPLY FKDPIFQARAAVPAPKVSDKLIQTATVEEGEGITI |
[1] Grahn AM et al (2000) Conjugative Type 4 secretion system of a novel large plasmid from the chemoautotroph Tetrathiobacter kashmirensis and construction of shuttle vectors for Alcaligenaceae. J Bacteriol. 182(6):1564-74. [PMID:10692361] |
[2] Cabezón E et al (1994) Conjugative Type 4 secretion system of a novel large plasmid from the chemoautotroph Tetrathiobacter kashmirensis and construction of shuttle vectors for Alcaligenaceae. J Bacteriol. 176(14):4455-8. [PMID:8021231] |
[3] Hamilton CM et al (2000) Conjugative Type 4 secretion system of a novel large plasmid from the chemoautotroph Tetrathiobacter kashmirensis and construction of shuttle vectors for Alcaligenaceae. J Bacteriol. 182(6):1541-8. [PMID:10692358] |
[4] Gomis-Rüth FX et al (2004) Conjugative Type 4 secretion system of a novel large plasmid from the chemoautotroph Tetrathiobacter kashmirensis and construction of shuttle vectors for Alcaligenaceae. Curr Pharm Des. 10(13):1551-65. [PMID:15134575] |
ID | 1 |
Plasmid name | RP4 |
GenBank accession number | X14165.1 |
Incompatibility group | IncP1 |
Genome size | 60099 bp |
Coordinate of oriT [Strand] | _ |
Drug resistance | resistance to carbenicillin, kanamycin, ampicillin and tetracycline |
Heavy-metal resistance | _ |
Virulence factor | _ |
Xenobiotic degradation | degradation of biphenyl and 4-chlorobiphenyl |
Host bacterium [NCBI Taxonomy ID] | Pseudomonas aeruginosa S8 [287] |
[1] Saunders JR et al (1972) Properties of RP4, an R factor which originated in Pseudomonas aeruginosa S8.. J Bacteriol. 112(2):690-6. [PMID:4628745] |
[2] Datta N et al (1971) Properties of an R factor from Pseudomonas aeruginosa. J Bacteriol. 108(3):1244-9. [PMID:4945193] |
[3] Toussaint A et al (2003) The biphenyl- and 4-chlorobiphenyl-catabolic transposon Tn4371, a member of a new family of genomic islands related to IncP and Ti plasmids. Appl Environ Microbiol. 69(8):4837-45. [PMID:12902278] |
[4] Springael D et al (1993) Identification of a catabolic transposon, Tn4371, carrying biphenyl and 4-chlorobiphenyl degradation genes in _i>Alcaligenes eutrophus A5. J Bacteriol. 175(6):1674-81. [PMID:8383664] |