 ID | 3 |
| Name | TraK_RP4  |
| GenBank accession number | CAA38339 |
| Length | 134 aa |
| UniProt ID | P17910 |
| PDB ID | _ |
| Pfam | _ |
| Note | TraK oriT binding protein |
| Protein sequence [Download] | MPKSYTDELAEWVESRAAKKRRRDEAAVAFLAVRADVEAALASGYALVTIWEHMRETGKV KFSYETFRSHARRHIKAKPADVPAPQAKAAEPAPAPKTPEPRRPKQGGKAEKPAPAAAPT GFTFNPTPDKKDLL |
Reference| [1] Pansegrau W et al (1988) The origin of conjugative IncP plasmid transfer: interaction with plasmid-encoded products and the nucleotide sequence at the relaxation site. Biochim Biophys Acta. 951(2-3):365-74. [PMID:2850014] |
| [2] Grahn AM et al (2000) Components of the RP4 Conjugative Transfer Apparatus Form an Envelope Structure Bridging Inner and Outer Membranes of Donor Cells: Implications for Related Macromolecule Transport Systems. J Bacteriol. 182(6):1564-74. [PMID:10692361] |
| [3] Pansegrau W et al (1990) In vitro assembly of relaxosomes at the transfer origin of plasmid RP4. Proc Natl Acad Sci U S A. 87(17):6555-9. [PMID:2168553] |