Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1937339..1937521 | Replicon | chromosome |
Accession | NZ_CP026962 | ||
Organism | Staphylococcus aureus strain FDAARGOS_6 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | RK64_RS14295 | Protein ID | WP_001801861.1 |
Coordinates | 1937339..1937434 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1937462..1937521 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RK64_RS09620 | 1932999..1933625 | + | 627 | WP_000669046.1 | hypothetical protein | - |
RK64_RS09625 | 1933666..1934010 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
RK64_RS09630 | 1934108..1934659 | + | 552 | WP_000414205.1 | hypothetical protein | - |
RK64_RS09635 | 1934877..1935518 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
RK64_RS09640 | 1935632..1935817 | - | 186 | WP_000809857.1 | hypothetical protein | - |
RK64_RS09645 | 1935819..1935995 | - | 177 | WP_000375476.1 | hypothetical protein | - |
RK64_RS09650 | 1936006..1936389 | - | 384 | WP_000070812.1 | hypothetical protein | - |
RK64_RS09660 | 1936993..1937136 | - | 144 | WP_001549059.1 | transposase | - |
RK64_RS14295 | 1937339..1937434 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1937462..1937521 | - | 60 | - | - | Antitoxin |
RK64_RS09670 | 1937557..1937658 | + | 102 | WP_001791893.1 | hypothetical protein | - |
RK64_RS09675 | 1937636..1937812 | - | 177 | Protein_1822 | transposase | - |
RK64_RS09680 | 1938006..1938383 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1930439..1970610 | 40171 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T96866 WP_001801861.1 NZ_CP026962:1937339-1937434 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T96866 NZ_CP026962:1937339-1937434 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT96866 NZ_CP026962:c1937521-1937462 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|