Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 338774..338954 | Replicon | chromosome |
Accession | NZ_CP026953 | ||
Organism | Staphylococcus aureus strain FDAARGOS_48 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | RL06_RS14940 | Protein ID | WP_001801861.1 |
Coordinates | 338774..338869 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 338897..338954 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RL06_RS01690 | 333937..334587 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
RL06_RS01695 | 334668..335663 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
RL06_RS01700 | 335738..336364 | + | 627 | WP_016170738.1 | hypothetical protein | - |
RL06_RS01705 | 336405..336746 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
RL06_RS01710 | 336847..337419 | + | 573 | WP_000414216.1 | hypothetical protein | - |
RL06_RS01715 | 337617..338629 | - | 1013 | Protein_331 | IS3 family transposase | - |
RL06_RS14940 | 338774..338869 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 338897..338954 | - | 58 | - | - | Antitoxin |
RL06_RS01720 | 338992..339093 | + | 102 | WP_001792025.1 | hypothetical protein | - |
RL06_RS01725 | 339071..339232 | - | 162 | Protein_334 | transposase | - |
RL06_RS01730 | 339223..339717 | - | 495 | Protein_335 | transposase | - |
RL06_RS01735 | 340169..341398 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
RL06_RS01740 | 341391..342947 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
RL06_RS01745 | 343111..343245 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA / selk | 333179..365786 | 32607 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T96773 WP_001801861.1 NZ_CP026953:338774-338869 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T96773 NZ_CP026953:338774-338869 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT96773 NZ_CP026953:c338954-338897 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|