Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 208650..208832 | Replicon | chromosome |
| Accession | NZ_CP026080 | ||
| Organism | Staphylococcus aureus strain FDAARGOS_12 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | RK70_RS14085 | Protein ID | WP_001801861.1 |
| Coordinates | 208737..208832 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 208650..208709 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RK70_RS01250 | 207788..208165 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| RK70_RS01255 | 208359..208535 | + | 177 | Protein_192 | transposase | - |
| RK70_RS01260 | 208513..208614 | - | 102 | WP_001791893.1 | hypothetical protein | - |
| - | 208650..208709 | + | 60 | - | - | Antitoxin |
| RK70_RS14085 | 208737..208832 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| RK70_RS01270 | 209035..209178 | + | 144 | WP_001549059.1 | transposase | - |
| RK70_RS01280 | 209782..210165 | + | 384 | WP_000070812.1 | hypothetical protein | - |
| RK70_RS01285 | 210176..210352 | + | 177 | WP_000375476.1 | hypothetical protein | - |
| RK70_RS01290 | 210354..210539 | + | 186 | WP_000809857.1 | hypothetical protein | - |
| RK70_RS01295 | 210653..211294 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| RK70_RS01300 | 211512..212063 | - | 552 | WP_000414205.1 | hypothetical protein | - |
| RK70_RS01305 | 212161..212505 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
| RK70_RS01310 | 212546..213172 | - | 627 | WP_000669046.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | hlgA / lukD | 175561..215732 | 40171 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T93231 WP_001801861.1 NZ_CP026080:c208832-208737 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T93231 NZ_CP026080:c208832-208737 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT93231 NZ_CP026080:208650-208709 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|