Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1831504..1831684 | Replicon | chromosome |
Accession | NZ_CP026079 | ||
Organism | Staphylococcus aureus strain FDAARGOS_9 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | RK67_RS14575 | Protein ID | WP_001801861.1 |
Coordinates | 1831589..1831684 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1831504..1831561 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RK67_RS09675 | 1827213..1827347 | + | 135 | WP_001791797.1 | hypothetical protein | - |
RK67_RS09680 | 1827511..1829067 | + | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
RK67_RS09685 | 1829060..1830289 | + | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
RK67_RS09690 | 1830741..1831235 | + | 495 | Protein_1772 | transposase | - |
RK67_RS09695 | 1831226..1831387 | + | 162 | Protein_1773 | transposase | - |
RK67_RS09700 | 1831365..1831466 | - | 102 | WP_001792025.1 | hypothetical protein | - |
- | 1831504..1831561 | + | 58 | - | - | Antitoxin |
RK67_RS14575 | 1831589..1831684 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
RK67_RS09705 | 1831829..1832841 | + | 1013 | Protein_1776 | IS3 family transposase | - |
RK67_RS09710 | 1833039..1833611 | - | 573 | WP_000414216.1 | hypothetical protein | - |
RK67_RS09715 | 1833712..1834053 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
RK67_RS09720 | 1834094..1834720 | - | 627 | WP_000669024.1 | hypothetical protein | - |
RK67_RS09725 | 1834795..1835790 | - | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
RK67_RS09730 | 1835871..1836521 | - | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | selk / hlgA / lukD | 1804672..1837279 | 32607 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T93228 WP_001801861.1 NZ_CP026079:c1831684-1831589 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T93228 NZ_CP026079:c1831684-1831589 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT93228 NZ_CP026079:1831504-1831561 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|