Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2703434..2703614 | Replicon | chromosome |
Accession | NZ_CP026063 | ||
Organism | Staphylococcus aureus strain FDAARGOS_14 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | RK72_RS14385 | Protein ID | WP_001801861.1 |
Coordinates | 2703434..2703529 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2703557..2703614 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RK72_RS13880 | 2698597..2699247 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
RK72_RS13885 | 2699328..2700323 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
RK72_RS13890 | 2700398..2701024 | + | 627 | WP_000669024.1 | hypothetical protein | - |
RK72_RS13895 | 2701065..2701406 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
RK72_RS13900 | 2701507..2702079 | + | 573 | WP_000414216.1 | hypothetical protein | - |
RK72_RS13905 | 2702277..2703289 | - | 1013 | Protein_2599 | IS3 family transposase | - |
RK72_RS14385 | 2703434..2703529 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 2703557..2703614 | - | 58 | - | - | Antitoxin |
RK72_RS13910 | 2703652..2703753 | + | 102 | WP_001792025.1 | hypothetical protein | - |
RK72_RS13915 | 2703731..2703892 | - | 162 | Protein_2602 | transposase | - |
RK72_RS13920 | 2703883..2704377 | - | 495 | Protein_2603 | transposase | - |
RK72_RS13925 | 2704829..2706058 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
RK72_RS13930 | 2706051..2707607 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
RK72_RS13935 | 2707771..2707905 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA / selk | 2697839..2730447 | 32608 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T92986 WP_001801861.1 NZ_CP026063:2703434-2703529 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T92986 NZ_CP026063:2703434-2703529 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT92986 NZ_CP026063:c2703614-2703557 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|