Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 221983..222198 | Replicon | chromosome |
Accession | NZ_CP025046 | ||
Organism | Clostridioides difficile strain W0022a |
Toxin (Protein)
Gene name | CD2889 | Uniprot ID | Q183X5 |
Locus tag | CWR55_RS01335 | Protein ID | WP_011861731.1 |
Coordinates | 221983..222126 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | RCd11 | ||
Locus tag | - | ||
Coordinates | 222048..222198 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CWR55_RS01305 | 218499..218729 | + | 231 | WP_021364192.1 | hemolysin XhlA family protein | - |
CWR55_RS01310 | 218749..219006 | + | 258 | WP_009898413.1 | phage holin family protein | - |
CWR55_RS01315 | 219006..219818 | + | 813 | WP_016056343.1 | N-acetylmuramoyl-L-alanine amidase | - |
CWR55_RS01320 | 220068..220559 | + | 492 | WP_016056344.1 | hypothetical protein | - |
CWR55_RS01325 | 220561..221127 | + | 567 | WP_016056345.1 | hypothetical protein | - |
CWR55_RS01330 | 221537..221725 | - | 189 | WP_009898401.1 | hypothetical protein | - |
CWR55_RS01335 | 221983..222126 | + | 144 | WP_011861731.1 | hypothetical protein | Toxin |
- | 222048..222198 | - | 151 | NuclAT_1 | - | Antitoxin |
- | 222052..222198 | - | 147 | NuclAT_2 | - | - |
CWR55_RS01340 | 222634..223023 | + | 390 | WP_021376798.1 | BlaI/MecI/CopY family transcriptional regulator | - |
CWR55_RS01345 | 223117..223500 | + | 384 | WP_021364164.1 | BlaI/MecI/CopY family transcriptional regulator | - |
CWR55_RS01355 | 224179..225609 | + | 1431 | WP_021362134.1 | metallophosphoesterase | - |
CWR55_RS01360 | 225757..226107 | - | 351 | Protein_221 | LysR family transcriptional regulator | - |
CWR55_RS01365 | 226102..226623 | + | 522 | WP_011860666.1 | chromate transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | groEL | 162357..223500 | 61143 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5399.34 Da Isoelectric Point: 10.8277
>T89602 WP_011861731.1 NZ_CP025046:221983-222126 [Clostridioides difficile]
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKFNKKRH
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKFNKKRH
Download Length: 144 bp
>T89602 NZ_CP025046:221983-222126 [Clostridioides difficile]
ATGAGCGAATTTTTACTAGGAGTGTTAGCTAGTTTAACAGCTAGCTTTATTACATATATTATTTCCAGAAAAGTAAAAAG
CCACTCTGGCAGGAGTGACTTTGAGCTTGATGTAAAAATCAAGTTTAATAAAAAACGACATTAA
ATGAGCGAATTTTTACTAGGAGTGTTAGCTAGTTTAACAGCTAGCTTTATTACATATATTATTTCCAGAAAAGTAAAAAG
CCACTCTGGCAGGAGTGACTTTGAGCTTGATGTAAAAATCAAGTTTAATAAAAAACGACATTAA
Antitoxin
Download Length: 151 bp
>AT89602 NZ_CP025046:c222198-222048 [Clostridioides difficile]
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTC
GTTTTTTATTAAACTTGATTTTTACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTTTCTG
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTC
GTTTTTTATTAAACTTGATTTTTACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTTTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|