Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2435158..2435360 | Replicon | chromosome |
Accession | NZ_CP025045 | ||
Organism | Clostridioides difficile strain W0023a |
Toxin (Protein)
Gene name | CD2299.1 | Uniprot ID | Q185H1 |
Locus tag | CWR56_RS11415 | Protein ID | WP_004454589.1 |
Coordinates | 2435208..2435360 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | SQ1641 | ||
Locus tag | - | ||
Coordinates | 2435158..2435287 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CWR56_RS11385 | 2430462..2430926 | + | 465 | WP_004454576.1 | hypothetical protein | - |
CWR56_RS11395 | 2431255..2431416 | - | 162 | WP_004454578.1 | hypothetical protein | - |
CWR56_RS19105 | 2431468..2432281 | - | 814 | Protein_2156 | toxin Bro | - |
CWR56_RS19110 | 2432402..2432554 | - | 153 | WP_009897477.1 | hypothetical protein | - |
CWR56_RS11410 | 2434091..2435014 | - | 924 | WP_004454587.1 | SHOCT domain-containing protein | - |
- | 2435158..2435287 | + | 130 | NuclAT_1 | - | Antitoxin |
CWR56_RS11415 | 2435208..2435360 | - | 153 | WP_004454589.1 | hypothetical protein | Toxin |
CWR56_RS11420 | 2435634..2435957 | - | 324 | WP_009897482.1 | hypothetical protein | - |
CWR56_RS11425 | 2435993..2436247 | - | 255 | WP_004454592.1 | hypothetical protein | - |
CWR56_RS11435 | 2436679..2437197 | - | 519 | Protein_2162 | transposase | - |
CWR56_RS11440 | 2437487..2437861 | - | 375 | Protein_2163 | BlaI/MecI/CopY family transcriptional regulator | - |
CWR56_RS11445 | 2437966..2438340 | - | 375 | WP_004454597.1 | BlaI/MecI/CopY family transcriptional regulator | - |
CWR56_RS11450 | 2439146..2439634 | + | 489 | WP_004454599.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
CWR56_RS19050 | 2440023..2440193 | + | 171 | WP_004454601.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2426885..2445443 | 18558 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T89596 WP_004454589.1 NZ_CP025045:c2435360-2435208 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
>T89596 NZ_CP025045:c2435360-2435208 [Clostridioides difficile]
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
Antitoxin
Download Length: 130 bp
>AT89596 NZ_CP025045:2435158-2435287 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|