Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1913314..1913496 | Replicon | chromosome |
| Accession | NZ_CP022906 | ||
| Organism | Staphylococcus aureus strain 546 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | CGP99_RS09795 | Protein ID | WP_001801861.1 |
| Coordinates | 1913314..1913409 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1913437..1913496 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CGP99_RS09745 | 1908974..1909600 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| CGP99_RS09750 | 1909641..1909985 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| CGP99_RS09755 | 1910083..1910634 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| CGP99_RS09760 | 1910852..1911493 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| CGP99_RS09765 | 1911607..1911792 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| CGP99_RS09770 | 1911794..1911970 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| CGP99_RS09775 | 1911981..1912364 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| CGP99_RS09785 | 1912968..1913111 | - | 144 | WP_001549059.1 | transposase | - |
| CGP99_RS09795 | 1913314..1913409 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1913437..1913496 | - | 60 | - | - | Antitoxin |
| CGP99_RS09800 | 1913532..1913633 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| CGP99_RS09805 | 1913611..1913787 | - | 177 | Protein_1841 | transposase | - |
| CGP99_RS09810 | 1913981..1914358 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| CGP99_RS09815 | 1914879..1915706 | - | 828 | Protein_1843 | ATP-binding protein | - |
| CGP99_RS09820 | 1915756..1916928 | - | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA | 1906414..1947802 | 41388 | ||
| - | flank | IS/Tn | - | - | 1915756..1916928 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T80079 WP_001801861.1 NZ_CP022906:1913314-1913409 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T80079 NZ_CP022906:1913314-1913409 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT80079 NZ_CP022906:c1913496-1913437 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|