Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1667782..1667962 | Replicon | chromosome |
Accession | NZ_CP022903 | ||
Organism | Staphylococcus aureus strain 187 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CGQ01_RS08530 | Protein ID | WP_001801861.1 |
Coordinates | 1667782..1667877 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1667905..1667962 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CGQ01_RS08500 | 1662945..1663595 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
CGQ01_RS08505 | 1663676..1664671 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
CGQ01_RS08510 | 1664746..1665372 | + | 627 | WP_000669024.1 | hypothetical protein | - |
CGQ01_RS08515 | 1665413..1665754 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
CGQ01_RS08520 | 1665855..1666427 | + | 573 | WP_000414216.1 | hypothetical protein | - |
CGQ01_RS08525 | 1666625..1667637 | - | 1013 | Protein_1595 | IS3 family transposase | - |
CGQ01_RS08530 | 1667782..1667877 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1667905..1667962 | - | 58 | - | - | Antitoxin |
CGQ01_RS08535 | 1668000..1668101 | + | 102 | WP_001792025.1 | hypothetical protein | - |
CGQ01_RS08540 | 1668079..1668240 | - | 162 | Protein_1598 | transposase | - |
CGQ01_RS08545 | 1668231..1668725 | - | 495 | Protein_1599 | transposase | - |
CGQ01_RS08550 | 1669177..1670406 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
CGQ01_RS08555 | 1670399..1671955 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
CGQ01_RS08560 | 1672119..1672253 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA / selk | 1662187..1700129 | 37942 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T80031 WP_001801861.1 NZ_CP022903:1667782-1667877 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T80031 NZ_CP022903:1667782-1667877 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT80031 NZ_CP022903:c1667962-1667905 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|