Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1913310..1913492 | Replicon | chromosome |
Accession | NZ_CP022902 | ||
Organism | Staphylococcus aureus strain 165 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CGP98_RS09795 | Protein ID | WP_001801861.1 |
Coordinates | 1913310..1913405 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1913433..1913492 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CGP98_RS09745 | 1908970..1909596 | + | 627 | WP_000669046.1 | hypothetical protein | - |
CGP98_RS09750 | 1909637..1909981 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
CGP98_RS09755 | 1910079..1910630 | + | 552 | WP_000414205.1 | hypothetical protein | - |
CGP98_RS09760 | 1910848..1911489 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
CGP98_RS09765 | 1911603..1911788 | - | 186 | WP_000809857.1 | hypothetical protein | - |
CGP98_RS09770 | 1911790..1911966 | - | 177 | WP_000375476.1 | hypothetical protein | - |
CGP98_RS09775 | 1911977..1912360 | - | 384 | WP_000070811.1 | hypothetical protein | - |
CGP98_RS09785 | 1912964..1913107 | - | 144 | WP_001549059.1 | transposase | - |
CGP98_RS09795 | 1913310..1913405 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1913433..1913492 | - | 60 | - | - | Antitoxin |
CGP98_RS09800 | 1913528..1913629 | + | 102 | WP_001791893.1 | hypothetical protein | - |
CGP98_RS09805 | 1913607..1913783 | - | 177 | Protein_1840 | transposase | - |
CGP98_RS09810 | 1913977..1914354 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
CGP98_RS09815 | 1914875..1915702 | - | 828 | Protein_1842 | ATP-binding protein | - |
CGP98_RS09820 | 1915752..1916924 | - | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1906410..1947798 | 41388 | ||
- | flank | IS/Tn | - | - | 1915752..1916924 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T80010 WP_001801861.1 NZ_CP022902:1913310-1913405 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T80010 NZ_CP022902:1913310-1913405 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT80010 NZ_CP022902:c1913492-1913433 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|