Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1184591..1184771 | Replicon | chromosome |
Accession | NZ_CP022894 | ||
Organism | Staphylococcus aureus strain 191 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CGP90_RS06375 | Protein ID | WP_001801861.1 |
Coordinates | 1184676..1184771 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1184591..1184648 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CGP90_RS06345 | 1180300..1180434 | + | 135 | WP_001791797.1 | hypothetical protein | - |
CGP90_RS06350 | 1180598..1182154 | + | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
CGP90_RS06355 | 1182147..1183376 | + | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
CGP90_RS06360 | 1183828..1184322 | + | 495 | Protein_1142 | transposase | - |
CGP90_RS06365 | 1184313..1184474 | + | 162 | Protein_1143 | transposase | - |
CGP90_RS06370 | 1184452..1184553 | - | 102 | WP_001792025.1 | hypothetical protein | - |
- | 1184591..1184648 | + | 58 | - | - | Antitoxin |
CGP90_RS06375 | 1184676..1184771 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
CGP90_RS06380 | 1184916..1185928 | + | 1013 | Protein_1146 | IS3 family transposase | - |
CGP90_RS06385 | 1186126..1186698 | - | 573 | WP_000414216.1 | hypothetical protein | - |
CGP90_RS06390 | 1186799..1187140 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
CGP90_RS06395 | 1187181..1187807 | - | 627 | WP_000669024.1 | hypothetical protein | - |
CGP90_RS06400 | 1187882..1188877 | - | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
CGP90_RS06405 | 1188958..1189608 | - | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | selk / hlgA / lukD | 1155094..1189572 | 34478 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T79888 WP_001801861.1 NZ_CP022894:c1184771-1184676 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T79888 NZ_CP022894:c1184771-1184676 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT79888 NZ_CP022894:1184591-1184648 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|