Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1184590..1184770 | Replicon | chromosome |
Accession | NZ_CP022893 | ||
Organism | Staphylococcus aureus strain 61 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CGP89_RS06375 | Protein ID | WP_001801861.1 |
Coordinates | 1184675..1184770 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1184590..1184647 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CGP89_RS06345 | 1180299..1180433 | + | 135 | WP_001791797.1 | hypothetical protein | - |
CGP89_RS06350 | 1180597..1182153 | + | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
CGP89_RS06355 | 1182146..1183375 | + | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
CGP89_RS06360 | 1183827..1184321 | + | 495 | Protein_1142 | transposase | - |
CGP89_RS06365 | 1184312..1184473 | + | 162 | Protein_1143 | transposase | - |
CGP89_RS06370 | 1184451..1184552 | - | 102 | WP_001792025.1 | hypothetical protein | - |
- | 1184590..1184647 | + | 58 | - | - | Antitoxin |
CGP89_RS06375 | 1184675..1184770 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
CGP89_RS06380 | 1184915..1185927 | + | 1013 | Protein_1146 | IS3 family transposase | - |
CGP89_RS06385 | 1186125..1186697 | - | 573 | WP_000414216.1 | hypothetical protein | - |
CGP89_RS06390 | 1186798..1187139 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
CGP89_RS06395 | 1187180..1187806 | - | 627 | WP_000669024.1 | hypothetical protein | - |
CGP89_RS06400 | 1187881..1188876 | - | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
CGP89_RS06405 | 1188957..1189607 | - | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | selk / hlgA / lukD | 1155093..1189571 | 34478 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T79872 WP_001801861.1 NZ_CP022893:c1184770-1184675 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T79872 NZ_CP022893:c1184770-1184675 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT79872 NZ_CP022893:1184590-1184647 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|