Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2490043..2490245 | Replicon | chromosome |
Accession | NZ_CP021447 | ||
Organism | Clostridioides difficile strain DSM 104451 |
Toxin (Protein)
Gene name | CD2299.1 | Uniprot ID | Q185H1 |
Locus tag | CDIF104451_RS11795 | Protein ID | WP_004454589.1 |
Coordinates | 2490093..2490245 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | SQ1641 | ||
Locus tag | - | ||
Coordinates | 2490043..2490172 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDIF104451_RS11760 (2485425) | 2485425..2485742 | + | 318 | WP_009897465.1 | hypothetical protein | - |
CDIF104451_RS11765 (2485878) | 2485878..2486342 | + | 465 | WP_011861514.1 | hypothetical protein | - |
CDIF104451_RS11770 (2486670) | 2486670..2486831 | - | 162 | WP_004454578.1 | hypothetical protein | - |
CDIF104451_RS11775 (2486883) | 2486883..2487335 | - | 453 | WP_009897470.1 | hypothetical protein | - |
CDIF104451_RS11780 (2487332) | 2487332..2487697 | - | 366 | WP_009897471.1 | Bro-N domain-containing protein | - |
CDIF104451_RS11785 (2487817) | 2487817..2487969 | - | 153 | WP_009897477.1 | hypothetical protein | - |
CDIF104451_RS11790 (2489330) | 2489330..2489824 | - | 495 | WP_231310087.1 | hypothetical protein | - |
- (2490043) | 2490043..2490172 | + | 130 | NuclAT_4 | - | Antitoxin |
- (2490043) | 2490043..2490172 | + | 130 | NuclAT_4 | - | Antitoxin |
- (2490043) | 2490043..2490172 | + | 130 | NuclAT_7 | - | Antitoxin |
CDIF104451_RS11795 (2490093) | 2490093..2490245 | - | 153 | WP_004454589.1 | hypothetical protein | Toxin |
CDIF104451_RS11800 (2490519) | 2490519..2490842 | - | 324 | WP_009897482.1 | DUF6054 family protein | - |
CDIF104451_RS11805 (2490878) | 2490878..2491132 | - | 255 | WP_004454592.1 | hypothetical protein | - |
CDIF104451_RS11810 (2491564) | 2491564..2492082 | - | 519 | Protein_2248 | transposase | - |
CDIF104451_RS11815 (2492372) | 2492372..2492746 | - | 375 | Protein_2249 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF104451_RS11820 (2492851) | 2492851..2493225 | - | 375 | WP_004454597.1 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF104451_RS11825 (2494029) | 2494029..2494517 | + | 489 | WP_004454599.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
CDIF104451_RS11830 (2494902) | 2494902..2495076 | + | 175 | Protein_2252 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T76657 WP_004454589.1 NZ_CP021447:c2490245-2490093 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
>T76657 NZ_CP021447:c2490245-2490093 [Clostridioides difficile]
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
Antitoxin
Download Length: 130 bp
>AT76657 NZ_CP021447:2490043-2490172 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|