Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 1203431..1203646 | Replicon | chromosome |
Accession | NZ_CP021445 | ||
Organism | Clostridioides difficile strain DSM 104450 |
Toxin (Protein)
Gene name | CD2889 | Uniprot ID | Q183X5 |
Locus tag | CDIF104450_RS05950 | Protein ID | WP_011861731.1 |
Coordinates | 1203431..1203574 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | RCd10 | ||
Locus tag | - | ||
Coordinates | 1203496..1203646 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDIF104450_RS05925 (CDIF104450_01179) | 1199103..1199450 | + | 348 | WP_009898409.1 | hypothetical protein | - |
CDIF104450_RS05930 (CDIF104450_01180) | 1199616..1200134 | + | 519 | WP_009898407.1 | DUF5706 domain-containing protein | - |
CDIF104450_RS05935 (CDIF104450_01181) | 1200198..1201784 | - | 1587 | WP_015984865.1 | hypothetical protein | - |
CDIF104450_RS05940 (CDIF104450_01182) | 1201760..1202281 | - | 522 | WP_009898403.1 | ImmA/IrrE family metallo-endopeptidase | - |
CDIF104450_RS05945 (CDIF104450_01183) | 1202983..1203171 | - | 189 | WP_009898401.1 | hypothetical protein | - |
CDIF104450_RS05950 | 1203431..1203574 | + | 144 | WP_011861731.1 | hypothetical protein | Toxin |
- | 1203496..1203646 | - | 151 | - | - | Antitoxin |
CDIF104450_RS05955 (CDIF104450_01184) | 1204081..1204458 | + | 378 | WP_021391346.1 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF104450_RS05960 (CDIF104450_01185) | 1204568..1204951 | + | 384 | WP_015984867.1 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF104450_RS05965 (CDIF104450_01186) | 1205145..1205720 | + | 576 | WP_021360401.1 | GntR family transcriptional regulator | - |
CDIF104450_RS05970 (CDIF104450_01187) | 1205746..1206159 | + | 414 | WP_009896035.1 | PTS sugar transporter subunit IIA | - |
CDIF104450_RS05975 (CDIF104450_01188) | 1206163..1206906 | + | 744 | WP_003437997.1 | BtpA/SgcQ family protein | - |
CDIF104450_RS05980 (CDIF104450_01189) | 1206906..1207376 | + | 471 | WP_003428544.1 | PTS sugar transporter subunit IIB | - |
CDIF104450_RS05985 (CDIF104450_01190) | 1207393..1208151 | + | 759 | WP_009888882.1 | PTS sugar transporter subunit IIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1149304..1216973 | 67669 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5399.34 Da Isoelectric Point: 10.8277
>T76631 WP_011861731.1 NZ_CP021445:1203431-1203574 [Clostridioides difficile]
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKFNKKRH
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKFNKKRH
Download Length: 144 bp
>T76631 NZ_CP021445:1203431-1203574 [Clostridioides difficile]
ATGAGCGAATTTTTACTAGGAGTGTTAGCTAGTTTAACAGCTAGCTTTATTACATATATTATTTCCAGAAAAGTAAAAAG
CCACTCTGGCAGGAGTGACTTTGAGCTTGATGTAAAAATCAAGTTTAATAAAAAACGACATTAA
ATGAGCGAATTTTTACTAGGAGTGTTAGCTAGTTTAACAGCTAGCTTTATTACATATATTATTTCCAGAAAAGTAAAAAG
CCACTCTGGCAGGAGTGACTTTGAGCTTGATGTAAAAATCAAGTTTAATAAAAAACGACATTAA
Antitoxin
Download Length: 151 bp
>AT76631 NZ_CP021445:c1203646-1203496 [Clostridioides difficile]
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTC
GTTTTTTATTAAACTTGATTTTTACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTTTCTG
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTC
GTTTTTTATTAAACTTGATTTTTACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTTTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|