Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1805380..1805560 | Replicon | chromosome |
| Accession | NZ_CP021105 | ||
| Organism | Staphylococcus aureus strain CC5 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | Q8VVS0 |
| Locus tag | B4893_RS08980 | Protein ID | WP_001791613.1 |
| Coordinates | 1805380..1805472 (+) | Length | 31 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1805503..1805560 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B4893_RS08950 | 1800543..1801193 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| B4893_RS08955 | 1801274..1802269 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| B4893_RS08960 | 1802344..1802970 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| B4893_RS08965 | 1803011..1803352 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| B4893_RS08970 | 1803453..1804025 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| B4893_RS08975 | 1804223..1805235 | - | 1013 | Protein_1679 | IS3 family transposase | - |
| B4893_RS08980 | 1805380..1805472 | + | 93 | WP_001791613.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 1805503..1805560 | - | 58 | - | - | Antitoxin |
| B4893_RS08985 | 1805598..1805699 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| B4893_RS08990 | 1805677..1805838 | - | 162 | Protein_1682 | transposase | - |
| B4893_RS08995 | 1805829..1806323 | - | 495 | Protein_1683 | transposase | - |
| B4893_RS09000 | 1806775..1808004 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| B4893_RS09005 | 1807997..1809553 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| B4893_RS09010 | 1809717..1809851 | - | 135 | WP_001791797.1 | hypothetical protein | - |
| B4893_RS09015 | 1809914..1810389 | - | 476 | Protein_1687 | serine protease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA / selk | 1800579..1840970 | 40391 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 31 a.a. Molecular weight: 3471.23 Da Isoelectric Point: 9.7333
>T75971 WP_001791613.1 NZ_CP021105:1805380-1805472 [Staphylococcus aureus]
MLIIFVHIIAPVISGCAVAYYTYWLSKRNK
MLIIFVHIIAPVISGCAVAYYTYWLSKRNK
Download Length: 93 bp
>T75971 NZ_CP021105:1805380-1805472 [Staphylococcus aureus]
TTGCTAATCATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCTGTTGCGTATTATACTTATTGGCTTAGTAA
ACGCAACAAATAA
TTGCTAATCATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCTGTTGCGTATTATACTTATTGGCTTAGTAA
ACGCAACAAATAA
Antitoxin
Download Length: 58 bp
>AT75971 NZ_CP021105:c1805560-1805503 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|