Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1852411..1852593 | Replicon | chromosome |
Accession | NZ_CP020957 | ||
Organism | Staphylococcus aureus strain C3948 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | B9T42_RS09350 | Protein ID | WP_001801861.1 |
Coordinates | 1852411..1852506 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1852534..1852593 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B9T42_RS09300 | 1848071..1848697 | + | 627 | WP_000669046.1 | hypothetical protein | - |
B9T42_RS09305 | 1848738..1849082 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
B9T42_RS09310 | 1849180..1849731 | + | 552 | WP_000414205.1 | hypothetical protein | - |
B9T42_RS09315 | 1849949..1850590 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
B9T42_RS09320 | 1850704..1850889 | - | 186 | WP_000809857.1 | hypothetical protein | - |
B9T42_RS09325 | 1850891..1851067 | - | 177 | WP_000375476.1 | hypothetical protein | - |
B9T42_RS09330 | 1851078..1851461 | - | 384 | WP_000070811.1 | hypothetical protein | - |
B9T42_RS09340 | 1852065..1852208 | - | 144 | WP_001549059.1 | transposase | - |
B9T42_RS09350 | 1852411..1852506 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1852534..1852593 | - | 60 | - | - | Antitoxin |
B9T42_RS09355 | 1852629..1852730 | + | 102 | WP_001791893.1 | hypothetical protein | - |
B9T42_RS09360 | 1852708..1852884 | - | 177 | Protein_1760 | transposase | - |
B9T42_RS09365 | 1853078..1853455 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1845511..1885681 | 40170 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T75786 WP_001801861.1 NZ_CP020957:1852411-1852506 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T75786 NZ_CP020957:1852411-1852506 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT75786 NZ_CP020957:c1852593-1852534 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|