Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1930805..1930987 | Replicon | chromosome |
Accession | NZ_CP020619 | ||
Organism | Staphylococcus aureus strain JE2 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | B7H15_RS15365 | Protein ID | WP_001801861.1 |
Coordinates | 1930805..1930900 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1930928..1930987 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B7H15_RS09800 | 1926465..1927091 | + | 627 | Protein_1835 | hypothetical protein | - |
B7H15_RS09805 | 1927132..1927476 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
B7H15_RS09810 | 1927574..1928125 | + | 552 | WP_000414205.1 | hypothetical protein | - |
B7H15_RS09815 | 1928343..1928984 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
B7H15_RS09820 | 1929098..1929283 | - | 186 | WP_000809857.1 | hypothetical protein | - |
B7H15_RS09825 | 1929285..1929461 | - | 177 | WP_000375476.1 | hypothetical protein | - |
B7H15_RS09830 | 1929472..1929855 | - | 384 | WP_000070811.1 | hypothetical protein | - |
B7H15_RS09840 | 1930459..1930602 | - | 144 | WP_001549059.1 | transposase | - |
B7H15_RS15365 | 1930805..1930900 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1930928..1930987 | - | 60 | - | - | Antitoxin |
B7H15_RS09845 | 1931023..1931124 | + | 102 | WP_001791893.1 | hypothetical protein | - |
B7H15_RS09850 | 1931102..1931278 | - | 177 | Protein_1845 | transposase | - |
B7H15_RS09855 | 1931472..1931849 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1923905..1964076 | 40171 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T75189 WP_001801861.1 NZ_CP020619:1930805-1930900 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T75189 NZ_CP020619:1930805-1930900 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT75189 NZ_CP020619:c1930987-1930928 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|