Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2895471..2895688 | Replicon | chromosome |
Accession | NZ_CP020379 | ||
Organism | Clostridioides difficile strain DSM 102860 |
Toxin (Protein)
Gene name | CD2517.1 | Uniprot ID | - |
Locus tag | CDIF102860_RS14165 | Protein ID | WP_021375974.1 |
Coordinates | 2895530..2895688 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | CD630_n00500 | ||
Locus tag | - | ||
Coordinates | 2895471..2895514 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDIF102860_RS14150 | 2891908..2893536 | + | 1629 | WP_021376019.1 | aspartate 4-decarboxylase | - |
CDIF102860_RS14155 | 2893657..2894652 | + | 996 | WP_021376103.1 | asparaginase | - |
CDIF102860_RS14160 | 2894814..2894984 | - | 171 | WP_077708801.1 | IS3 family transposase | - |
- | 2895471..2895514 | + | 44 | NuclAT_4 | - | Antitoxin |
CDIF102860_RS14165 | 2895530..2895688 | - | 159 | WP_021375974.1 | hypothetical protein | Toxin |
CDIF102860_RS14170 | 2896110..2898530 | - | 2421 | WP_021376018.1 | leucine--tRNA ligase | - |
CDIF102860_RS14175 | 2898884..2899234 | - | 351 | WP_003416416.1 | ribosome silencing factor | - |
CDIF102860_RS14180 | 2899351..2899923 | - | 573 | WP_003431048.1 | bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK | - |
CDIF102860_RS14185 | 2899924..2900613 | - | 690 | WP_118090923.1 | nicotinate-nucleotide adenylyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6026.23 Da Isoelectric Point: 11.3102
>T74476 WP_021375974.1 NZ_CP020379:c2895688-2895530 [Clostridioides difficile]
MDNFLQGILASLSASLIVYITSKLFGKRKKPLKAATKSGWEFDFKIKFRRFK
MDNFLQGILASLSASLIVYITSKLFGKRKKPLKAATKSGWEFDFKIKFRRFK
Download Length: 159 bp
>T74476 NZ_CP020379:c2895688-2895530 [Clostridioides difficile]
ATGGATAATTTTTTACAAGGTATACTAGCGAGTCTATCTGCTAGTTTAATAGTCTATATAACTAGCAAGTTATTTGGAAA
ACGTAAAAAACCACTCAAAGCTGCAACTAAGAGTGGTTGGGAGTTTGATTTTAAAATCAAATTCCGTAGATTTAAATAA
ATGGATAATTTTTTACAAGGTATACTAGCGAGTCTATCTGCTAGTTTAATAGTCTATATAACTAGCAAGTTATTTGGAAA
ACGTAAAAAACCACTCAAAGCTGCAACTAAGAGTGGTTGGGAGTTTGATTTTAAAATCAAATTCCGTAGATTTAAATAA
Antitoxin
Download Length: 44 bp
>AT74476 NZ_CP020379:2895471-2895514 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTAGACGTAGAGTGGAGTTCATAAT
AAGAAGAACTACAATCTATTTAGACGTAGAGTGGAGTTCATAAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|