Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 1499311..1499513 | Replicon | chromosome |
Accession | NZ_CP019870 | ||
Organism | Clostridioides difficile strain BR81 |
Toxin (Protein)
Gene name | CD2299.1 | Uniprot ID | Q185H1 |
Locus tag | BZ168_RS06490 | Protein ID | WP_004454589.1 |
Coordinates | 1499311..1499463 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | SQ1641 | ||
Locus tag | - | ||
Coordinates | 1499384..1499513 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BZ168_RS18965 | 1494478..1494648 | - | 171 | WP_004454601.1 | hypothetical protein | - |
BZ168_RS06460 | 1495037..1495525 | - | 489 | WP_004454599.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
BZ168_RS06465 | 1496331..1496705 | + | 375 | WP_004454597.1 | BlaI/MecI/CopY family transcriptional regulator | - |
BZ168_RS18970 | 1496810..1497184 | + | 375 | Protein_1272 | BlaI/MecI/CopY family transcriptional regulator | - |
BZ168_RS06475 | 1497474..1497992 | + | 519 | Protein_1273 | transposase | - |
BZ168_RS06480 | 1498424..1498678 | + | 255 | WP_004454592.1 | hypothetical protein | - |
BZ168_RS06485 | 1498714..1499037 | + | 324 | WP_009897482.1 | hypothetical protein | - |
BZ168_RS06490 | 1499311..1499463 | + | 153 | WP_004454589.1 | hypothetical protein | Toxin |
- | 1499384..1499513 | - | 130 | NuclAT_1 | - | Antitoxin |
BZ168_RS06495 | 1499657..1500580 | + | 924 | WP_004454587.1 | SHOCT domain-containing protein | - |
BZ168_RS19170 | 1502117..1502269 | + | 153 | WP_009897477.1 | hypothetical protein | - |
BZ168_RS19175 | 1502390..1503203 | + | 814 | Protein_1279 | toxin Bro | - |
BZ168_RS06510 | 1503255..1503416 | + | 162 | WP_004454578.1 | hypothetical protein | - |
BZ168_RS06520 | 1503745..1504209 | - | 465 | WP_004454576.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1434060..1514622 | 80562 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T73396 WP_004454589.1 NZ_CP019870:1499311-1499463 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
>T73396 NZ_CP019870:1499311-1499463 [Clostridioides difficile]
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
Antitoxin
Download Length: 130 bp
>AT73396 NZ_CP019870:c1499513-1499384 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|