Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2515324..2515526 | Replicon | chromosome |
Accession | NZ_CP019860 | ||
Organism | Clostridioides difficile strain DSM 29632 |
Toxin (Protein)
Gene name | CD2299.1 | Uniprot ID | Q185H1 |
Locus tag | CDIF29632_RS11990 | Protein ID | WP_004454589.1 |
Coordinates | 2515374..2515526 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | SQ1641 | ||
Locus tag | - | ||
Coordinates | 2515324..2515453 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDIF29632_RS11955 | 2510639..2510956 | + | 318 | WP_004454574.1 | hypothetical protein | - |
CDIF29632_RS11960 | 2511092..2511556 | + | 465 | WP_021365574.1 | hypothetical protein | - |
CDIF29632_RS11970 | 2511880..2512041 | - | 162 | WP_004454578.1 | hypothetical protein | - |
CDIF29632_RS11975 | 2512093..2512545 | - | 453 | WP_021422473.1 | hypothetical protein | - |
CDIF29632_RS11980 | 2512542..2512907 | - | 366 | WP_016729316.1 | Bro-N domain-containing protein | - |
CDIF29632_RS19560 | 2513028..2513180 | - | 153 | WP_009897477.1 | hypothetical protein | - |
CDIF29632_RS11985 | 2514296..2515180 | - | 885 | WP_009897481.1 | hypothetical protein | - |
- | 2515324..2515453 | + | 130 | NuclAT_5 | - | Antitoxin |
CDIF29632_RS11990 | 2515374..2515526 | - | 153 | WP_004454589.1 | hypothetical protein | Toxin |
CDIF29632_RS11995 | 2515800..2516123 | - | 324 | WP_009897482.1 | hypothetical protein | - |
CDIF29632_RS12000 | 2516159..2516413 | - | 255 | WP_004454592.1 | hypothetical protein | - |
CDIF29632_RS12010 | 2516845..2517363 | - | 519 | Protein_2220 | transposase | - |
CDIF29632_RS12015 | 2517653..2518027 | - | 375 | Protein_2221 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF29632_RS12020 | 2518132..2518506 | - | 375 | WP_004454597.1 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF29632_RS12025 | 2519310..2519798 | + | 489 | WP_004454599.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
CDIF29632_RS12030 | 2520187..2520357 | + | 171 | WP_021394397.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2508819..2525606 | 16787 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T73376 WP_004454589.1 NZ_CP019860:c2515526-2515374 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
>T73376 NZ_CP019860:c2515526-2515374 [Clostridioides difficile]
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
Antitoxin
Download Length: 130 bp
>AT73376 NZ_CP019860:2515324-2515453 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|