Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 1291943..1292148 | Replicon | chromosome |
Accession | NZ_CP019860 | ||
Organism | Clostridioides difficile strain DSM 29632 |
Toxin (Protein)
Gene name | CD1233.1 | Uniprot ID | A0A069A9H6 |
Locus tag | CDIF29632_RS06160 | Protein ID | WP_009896140.1 |
Coordinates | 1291943..1292095 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | SQ808 | ||
Locus tag | - | ||
Coordinates | 1292075..1292148 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDIF29632_RS06140 | 1287405..1287689 | - | 285 | WP_003419254.1 | sigma-70 family RNA polymerase sigma factor | - |
CDIF29632_RS06145 | 1287712..1289229 | - | 1518 | WP_003438169.1 | recombinase family protein | - |
CDIF29632_RS06150 | 1289354..1290175 | - | 822 | WP_070538406.1 | tetratricopeptide repeat protein | - |
CDIF29632_RS06155 | 1290366..1291793 | + | 1428 | WP_074431859.1 | cell wall-binding protein Cwp26 | - |
CDIF29632_RS06160 | 1291943..1292095 | + | 153 | WP_009896140.1 | hypothetical protein | Toxin |
- | 1292075..1292148 | - | 74 | NuclAT_7 | - | Antitoxin |
CDIF29632_RS06170 | 1294946..1295101 | + | 156 | WP_003438173.1 | hypothetical protein | - |
CDIF29632_RS06180 | 1295347..1295598 | + | 252 | WP_003419270.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5811.96 Da Isoelectric Point: 11.1039
>T73367 WP_009896140.1 NZ_CP019860:1291943-1292095 [Clostridioides difficile]
MDNFLFNVLASLTASVVVYLISKLFKKAKSHSRTKSDLRVEFKFIFKSKK
MDNFLFNVLASLTASVVVYLISKLFKKAKSHSRTKSDLRVEFKFIFKSKK
Download Length: 153 bp
>T73367 NZ_CP019860:1291943-1292095 [Clostridioides difficile]
ATGGATAACTTTTTGTTTAATGTTTTAGCTAGTTTAACAGCTAGTGTGGTAGTTTACTTAATCAGTAAACTATTCAAAAA
AGCAAAAAGCCACTCTCGCACAAAGAGTGACTTACGAGTTGAATTTAAATTTATATTTAAATCCAAAAAATAA
ATGGATAACTTTTTGTTTAATGTTTTAGCTAGTTTAACAGCTAGTGTGGTAGTTTACTTAATCAGTAAACTATTCAAAAA
AGCAAAAAGCCACTCTCGCACAAAGAGTGACTTACGAGTTGAATTTAAATTTATATTTAAATCCAAAAAATAA
Antitoxin
Download Length: 74 bp
>AT73367 NZ_CP019860:c1292148-1292075 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTTGCGTTAGAGTGGAGTTCATCATAAACAGAGTTTATTTTTTGGATTTAAATAT
AAGAAGAACTACAATCTATTTTGCGTTAGAGTGGAGTTCATCATAAACAGAGTTTATTTTTTGGATTTAAATAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|