Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2606687..2606889 | Replicon | chromosome |
Accession | NZ_CP019858 | ||
Organism | Clostridioides difficile strain DSM 29688 |
Toxin (Protein)
Gene name | CD2299.1 | Uniprot ID | Q185H1 |
Locus tag | CDIF29688_RS12975 | Protein ID | WP_004454589.1 |
Coordinates | 2606737..2606889 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | SQ1641 | ||
Locus tag | - | ||
Coordinates | 2606687..2606816 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDIF29688_RS12935 | 2601748..2601948 | + | 201 | WP_021362723.1 | hypothetical protein | - |
CDIF29688_RS12940 | 2602326..2602643 | + | 318 | WP_004454574.1 | hypothetical protein | - |
CDIF29688_RS12945 | 2602779..2603243 | + | 465 | WP_025782691.1 | hypothetical protein | - |
CDIF29688_RS12955 | 2603572..2603733 | - | 162 | WP_004454578.1 | hypothetical protein | - |
CDIF29688_RS12960 | 2603785..2604237 | - | 453 | WP_021366820.1 | hypothetical protein | - |
CDIF29688_RS12965 | 2604234..2604599 | - | 366 | WP_016729316.1 | Bro-N domain-containing protein | - |
CDIF29688_RS20325 | 2604720..2604872 | - | 153 | WP_009897477.1 | hypothetical protein | - |
CDIF29688_RS12970 | 2605621..2606543 | - | 923 | Protein_2408 | SHOCT domain-containing protein | - |
- | 2606687..2606816 | + | 130 | NuclAT_7 | - | Antitoxin |
CDIF29688_RS12975 | 2606737..2606889 | - | 153 | WP_004454589.1 | hypothetical protein | Toxin |
CDIF29688_RS12980 | 2607163..2607486 | - | 324 | WP_021366819.1 | hypothetical protein | - |
CDIF29688_RS12985 | 2607522..2607776 | - | 255 | WP_025782692.1 | hypothetical protein | - |
CDIF29688_RS12990 | 2608084..2608581 | - | 498 | Protein_2412 | transposase | - |
CDIF29688_RS12995 | 2608871..2609246 | - | 376 | Protein_2413 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF29688_RS13000 | 2609351..2609728 | - | 378 | WP_021366893.1 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF29688_RS13005 | 2610533..2611027 | + | 495 | WP_021364347.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
CDIF29688_RS13010 | 2611416..2611586 | + | 171 | WP_032509469.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2599203..2615336 | 16133 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T73361 WP_004454589.1 NZ_CP019858:c2606889-2606737 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
>T73361 NZ_CP019858:c2606889-2606737 [Clostridioides difficile]
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACTGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACTGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
Antitoxin
Download Length: 130 bp
>AT73361 NZ_CP019858:2606687-2606816 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCAGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCAGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|