Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 1203398..1203613 | Replicon | chromosome |
Accession | NZ_CP019858 | ||
Organism | Clostridioides difficile strain DSM 29688 |
Toxin (Protein)
Gene name | CD2889 | Uniprot ID | Q183X5 |
Locus tag | CDIF29688_RS06060 | Protein ID | WP_011861731.1 |
Coordinates | 1203398..1203541 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | RCd10 | ||
Locus tag | - | ||
Coordinates | 1203463..1203613 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDIF29688_RS06035 | 1199055..1199417 | + | 363 | WP_015984864.1 | hypothetical protein | - |
CDIF29688_RS06040 | 1199583..1200101 | + | 519 | WP_009898407.1 | hypothetical protein | - |
CDIF29688_RS06045 | 1200165..1201751 | - | 1587 | WP_015984865.1 | hypothetical protein | - |
CDIF29688_RS06050 | 1201727..1202248 | - | 522 | WP_009898403.1 | ImmA/IrrE family metallo-endopeptidase | - |
CDIF29688_RS06055 | 1202950..1203138 | - | 189 | WP_009898401.1 | hypothetical protein | - |
CDIF29688_RS06060 | 1203398..1203541 | + | 144 | WP_011861731.1 | hypothetical protein | Toxin |
- | 1203463..1203613 | - | 151 | NuclAT_1 | - | Antitoxin |
- | 1203467..1203613 | - | 147 | NuclAT_0 | - | - |
CDIF29688_RS06065 | 1204048..1204425 | + | 378 | WP_021391346.1 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF29688_RS06070 | 1204535..1204918 | + | 384 | WP_015984867.1 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF29688_RS06075 | 1205103..1205687 | + | 585 | Protein_1074 | GntR family transcriptional regulator | - |
CDIF29688_RS06080 | 1205713..1206126 | + | 414 | WP_009896035.1 | PTS sugar transporter subunit IIA | - |
CDIF29688_RS06085 | 1206130..1206873 | + | 744 | WP_003437997.1 | membrane complex biogenesis protein, BtpA family | - |
CDIF29688_RS06090 | 1206873..1207343 | + | 471 | WP_003428544.1 | PTS sugar transporter subunit IIB | - |
CDIF29688_RS06095 | 1207360..1208118 | + | 759 | WP_009888882.1 | PTS sugar transporter subunit IIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1149271..1225633 | 76362 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5399.34 Da Isoelectric Point: 10.8277
>T73348 WP_011861731.1 NZ_CP019858:1203398-1203541 [Clostridioides difficile]
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKFNKKRH
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKFNKKRH
Download Length: 144 bp
>T73348 NZ_CP019858:1203398-1203541 [Clostridioides difficile]
ATGAGCGAATTTTTACTAGGAGTGTTAGCTAGTTTAACAGCTAGCTTTATTACATATATTATTTCCAGAAAAGTAAAAAG
CCACTCTGGCAGGAGTGACTTTGAGCTTGATGTAAAAATCAAGTTTAATAAAAAACGACATTAA
ATGAGCGAATTTTTACTAGGAGTGTTAGCTAGTTTAACAGCTAGCTTTATTACATATATTATTTCCAGAAAAGTAAAAAG
CCACTCTGGCAGGAGTGACTTTGAGCTTGATGTAAAAATCAAGTTTAATAAAAAACGACATTAA
Antitoxin
Download Length: 151 bp
>AT73348 NZ_CP019858:c1203613-1203463 [Clostridioides difficile]
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTC
GTTTTTTATTAAACTTGATTTTTACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTTTCTG
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTC
GTTTTTTATTAAACTTGATTTTTACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTTTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|